NPDC1 (NM_015392) Human Mass Spec Standard

SKU
PH301415
NPDC1 MS Standard C13 and N15-labeled recombinant protein (NP_056207)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC201415]
Predicted MW 34.5 kDa
Protein Sequence
Protein Sequence
>RC201415 protein sequence
Red=Cloning site Green=Tags(s)

MATPLPPPSPRHLRLLRLLLSGLVLGAALRGAAAGHPDVAACPGSLDCALKRRARCPPGAHACGPCLQPF
QEDQQGLCVPRMRRPPGGGRPQPRLEDEIDFLAQELARKESGHSTPPLPKDRQRLPEPATLGFSARGQGL
ELGLPSTPGTPTPTPHTSLGSPVSSDPVHMSPLEPRGGQGDGLALVLILAFCVAGAAALSVASLCWCRLQ
REIRLTQKADYATAKAPGSPAAPRISPGDQRLAQSAEMYHYQHQRQQMLCLERHKEPPKELDTASSDEEN
EDGDFTVYECPGLAPTGEMEVRNPLFDHAALSAPLPAPSSPPALP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_056207
RefSeq Size 1548
RefSeq ORF 975
Synonyms CAB; CAB-; CAB-1; CAB1; NPDC-1
Locus ID 56654
UniProt ID Q9NQX5
Cytogenetics 9q34.3
Summary Suppresses oncogenic transformation in neural and non-neural cells and down-regulates neural cell proliferation. Might be involved in transcriptional regulation (By similarity).[UniProtKB/Swiss-Prot Function]
Protein Families Transmembrane
Write Your Own Review
You're reviewing:NPDC1 (NM_015392) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC414555 NPDC1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY414555 Transient overexpression lysate of neural proliferation, differentiation and control, 1 (NPDC1) 100 ug
$436.00
TP301415 Recombinant protein of human neural proliferation, differentiation and control, 1 (NPDC1), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP721231 Purified recombinant protein of Human neural proliferation, differentiation and control, 1 (NPDC1) 10 ug
$250.00
TP761315 Purified recombinant protein of Human neural proliferation, differentiation and control, 1 (NPDC1), full length, with N-terminal GST and C-terminal His tag, expressed in E. coli, 50ug 50 ug
$261.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.