OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

NPDC1 (NM_015392) Human Mass Spec Standard

Be the first to review this product
SKU
PH301415
NPDC1 MS Standard C13 and N15-labeled recombinant protein (NP_056207)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA341974 Rabbit Polyclonal Anti-NPDC1 Antibody
100 ul
$525.00
LY414555 Transient overexpression lysate of neural proliferation, differentiation and control, 1 (NPDC1) (as WB positive control) 100 ug
$436.00

Other products for "NPDC1 or NM_015392"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC201415
Predicted MW 34.5 kDa
Protein Sequence
Protein Sequence
>RC201415 protein sequence
Red=Cloning site Green=Tags(s)

MATPLPPPSPRHLRLLRLLLSGLVLGAALRGAAAGHPDVAACPGSLDCALKRRARCPPGAHACGPCLQPF
QEDQQGLCVPRMRRPPGGGRPQPRLEDEIDFLAQELARKESGHSTPPLPKDRQRLPEPATLGFSARGQGL
ELGLPSTPGTPTPTPHTSLGSPVSSDPVHMSPLEPRGGQGDGLALVLILAFCVAGAAALSVASLCWCRLQ
REIRLTQKADYATAKAPGSPAAPRISPGDQRLAQSAEMYHYQHQRQQMLCLERHKEPPKELDTASSDEEN
EDGDFTVYECPGLAPTGEMEVRNPLFDHAALSAPLPAPSSPPALP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_056207
RefSeq Size 1548
RefSeq ORF 975
Synonyms CAB; CAB-; CAB-1; CAB1; NPDC-1
Locus ID 56654
UniProt ID Q9NQX5
Cytogenetics 9q34.3
Summary Suppresses oncogenic transformation in neural and non-neural cells and down-regulates neural cell proliferation. Might be involved in transcriptional regulation (By similarity).UniProtKB/Swiss-Prot Function
Protein Families Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "NPDC1" proteins (5)
SKU Description Size Price
LC414555 Lyophilized NPDC1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY414555 Transient overexpression lysate of neural proliferation, differentiation and control, 1 (NPDC1) (as WB positive control) 100 ug
$436.00
TP301415 Recombinant protein of human neural proliferation, differentiation and control, 1 (NPDC1), 20 µg 20 ug
$867.00
TP721231 Purified recombinant protein of Human neural proliferation, differentiation and control, 1 (NPDC1) 10 ug
$260.00
TP761315 Purified recombinant protein of Human neural proliferation, differentiation and control, 1 (NPDC1), full length, with N-terminal GST and C-terminal His tag, expressed in E. coli, 50ug 50 ug
$270.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products