OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

ARF5 (NM_001662) Human Mass Spec Standard

Be the first to review this product
SKU
PH301363
ARF5 MS Standard C13 and N15-labeled recombinant protein (NP_001653)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA366698 ARF5 rabbit polyclonal antibody
100 ul
$310.00
LY400628 Transient overexpression lysate of ADP-ribosylation factor 5 (ARF5) (as WB positive control) 100 ug
$436.00

Other products for "ARF5 or NM_001662"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC201363
Predicted MW 20.5 kDa
Protein Sequence
Protein Sequence
>RC201363 protein sequence
Red=Cloning site Green=Tags(s)

MGLTVSALFSRIFGKKQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNICFTVWDVGG
QDKIRPLWRHYFQNTQGLIFVVDSNDRERVQESADELQKMLQEDELRDAVLLVFANKQDMPNAMPVSELT
DKLGLQHLRSRTWYVQATCATQGTGLYDGLDWLSHELSKR

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001653
RefSeq Size 1096
RefSeq ORF 540
Locus ID 381
UniProt ID P84085
Cytogenetics 7q32.1
Summary This gene is a member of the human ADP-ribosylation factor (ARF) gene family. These genes encode small guanine nucleotide-binding proteins that stimulate the ADP-ribosyltransferase activity of cholera toxin and play a role in vesicular trafficking and as activators of phospholipase D. The gene products include 6 ARF proteins and 11 ARF-like proteins and constitute 1 family of the RAS superfamily. The ARF proteins are categorized as class I (ARF1, ARF2,and ARF3), class II (ARF4 and ARF5) and class III (ARF6). The members of each class share a common gene organization. provided by RefSeq, Dec 2010
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "ARF5" proteins (3)
SKU Description Size Price
LC400628 Lyophilized ARF5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400628 Transient overexpression lysate of ADP-ribosylation factor 5 (ARF5) (as WB positive control) 100 ug
$436.00
TP301363 Recombinant protein of human ADP-ribosylation factor 5 (ARF5), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products