ARF5 (NM_001662) Human Tagged ORF Clone

SKU
RC201363
ARF5 (Myc-DDK-tagged)-Human ADP-ribosylation factor 5 (ARF5)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol ARF5
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC201363 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGCCTCACCGTGTCCGCGCTCTTTTCGCGGATCTTCGGGAAGAAGCAGATGCGGATTCTCATGGTTG
GCTTGGATGCGGCTGGCAAGACCACAATCCTGTACAAACTGAAGTTGGGGGAGATTGTCACCACCATCCC
AACCATAGGCTTCAATGTAGAAACAGTGGAATATAAGAACATCTGTTTCACAGTCTGGGACGTGGGAGGC
CAGGACAAGATTCGGCCTCTGTGGCGGCACTACTTCCAGAACACTCAGGGCCTCATCTTTGTGGTGGACA
GTAATGACCGGGAGCGGGTCCAAGAATCTGCTGATGAACTCCAGAAGATGCTGCAGGAGGACGAGCTGCG
GGATGCAGTGCTGCTGGTATTTGCCAACAAGCAGGACATGCCCAACGCCATGCCCGTGAGCGAGCTGACT
GACAAGCTGGGGCTACAGCACTTACGCAGCCGCACGTGGTATGTCCAGGCCACCTGTGCCACCCAAGGCA
CAGGTCTGTACGATGGTCTGGACTGGCTGTCCCACGAGCTGTCAAAGCGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC201363 protein sequence
Red=Cloning site Green=Tags(s)

MGLTVSALFSRIFGKKQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNICFTVWDVGG
QDKIRPLWRHYFQNTQGLIFVVDSNDRERVQESADELQKMLQEDELRDAVLLVFANKQDMPNAMPVSELT
DKLGLQHLRSRTWYVQATCATQGTGLYDGLDWLSHELSKR

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001662
ORF Size 540 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001662.4
RefSeq Size 1096 bp
RefSeq ORF 543 bp
Locus ID 381
UniProt ID P84085
Cytogenetics 7q32.1
Domains arf, ARF, RAB, SAR
MW 20.5 kDa
Summary This gene is a member of the human ADP-ribosylation factor (ARF) gene family. These genes encode small guanine nucleotide-binding proteins that stimulate the ADP-ribosyltransferase activity of cholera toxin and play a role in vesicular trafficking and as activators of phospholipase D. The gene products include 6 ARF proteins and 11 ARF-like proteins and constitute 1 family of the RAS superfamily. The ARF proteins are categorized as class I (ARF1, ARF2,and ARF3), class II (ARF4 and ARF5) and class III (ARF6). The members of each class share a common gene organization. [provided by RefSeq, Dec 2010]
Write Your Own Review
You're reviewing:ARF5 (NM_001662) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC201363L1 Lenti ORF clone of Human ADP-ribosylation factor 5 (ARF5), Myc-DDK-tagged 10 ug
$600.00
RC201363L2 Lenti ORF clone of Human ADP-ribosylation factor 5 (ARF5), mGFP tagged 10 ug
$600.00
RC201363L3 Lenti ORF clone of Human ADP-ribosylation factor 5 (ARF5), Myc-DDK-tagged 10 ug
$600.00
RC201363L4 Lenti ORF clone of Human ADP-ribosylation factor 5 (ARF5), mGFP tagged 10 ug
$600.00
RG201363 ARF5 (tGFP-tagged) - Human ADP-ribosylation factor 5 (ARF5) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC119094 ARF5 (untagged)-Human ADP-ribosylation factor 5 (ARF5) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.