PEX11C (PEX11G) (NM_080662) Human Mass Spec Standard

SKU
PH301338
PEX11G MS Standard C13 and N15-labeled recombinant protein (NP_542393)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC201338]
Predicted MW 26.6 kDa
Protein Sequence
Protein Sequence
>RC201338 protein sequence
Red=Cloning site Green=Tags(s)

MASLSGLASALESYRGRDRLIRVLGYCCQLVGGVLVEQCPARSEVGTRLLVVSTQLSHCRTILRLFDDLA
MFVYTKQYGLGAQEEDAFVRCVSVLGNLADQLYYPCEHVAWAADARVLHVDSSRWWTLSTTLWALSLLLG
VARSLWMLLKLRQRLRSPTAPFTSPLPRGKRRAMEAQMQSEALSLLSNLADLANAVHWLPRGVLWAGRFP
PWLVGLMGTISSILSMYQAARAGGQAEATTP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_542393
RefSeq Size 1086
RefSeq ORF 723
Locus ID 92960
UniProt ID Q96HA9
Cytogenetics 19p13.2
Summary The protein encoded by this gene is a member of the PEX11 family. This family is reported to regulate the number and size of peroxisomes in evolutionarily distant organisms. The protein encoded by this gene may induce clustering of peroxisomes. Alternative splicing results in multiple transcript variants that encode different protein isoforms. [provided by RefSeq, Jul 2012]
Write Your Own Review
You're reviewing:PEX11C (PEX11G) (NM_080662) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC403314 PEX11G HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY403314 Transient overexpression lysate of peroxisomal biogenesis factor 11 gamma (PEX11G) 100 ug
$436.00
TP301338 Recombinant protein of human peroxisomal biogenesis factor 11 gamma (PEX11G), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.