PEX11C (PEX11G) Rabbit Polyclonal Antibody

SKU TA331673

Rabbit Polyclonal Anti-PEX11G Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-PEX11G Antibody is: synthetic peptide directed towards the C-terminal region of Human PEX11G. Synthetic peptide located within the following region: LANAVHWLPRGVLWAGRFPPWLVGLMGTISSILSMYQAARAGGQAEATTP
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 27 kDa
• Gene Name: peroxisomal biogenesis factor 11 gamma
• Database Link:
  NP_542393
  Q96HA9
• Background: The protein encoded by this gene is a member of the PEX11 family. This family is reported to regulate the number and size of peroxisomes in evolutionarily distant organisms. The protein encoded by this gene may induce clustering of peroxisomes. Alternative splicing results in multiple transcript variants that encode different protein isoforms.
• Synonyms: MGC4281
• Note: Immunogen sequence homology: Human: 100%; Rabbit: 92%

Reference Data