PAFAH1B2 (NM_002572) Human Mass Spec Standard

SKU
PH301313
PAFAH1B2 MS Standard C13 and N15-labeled recombinant protein (NP_002563)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC201313]
Predicted MW 25.6 kDa
Protein Sequence
Protein Sequence
>RC201313 protein sequence
Red=Cloning site Green=Tags(s)

MSQGDSNPAAIPHAAEDIQGDDRWMSQHNRFVLDCKDKEPDVLFVGDSMVQLMQQYEIWRELFSPLHALN
FGIGGDTTRHVLWRLKNGELENIKPKVIVVWVGTNNHENTAEEVAGGIEAIVQLINTRQPQAKIIVLGLL
PRGEKPNPLRQKNAKVNQLLKVSLPKLANVQLLDTDGGFVHSDGAISCHDMFDFLHLTGGGYAKICKPLH
ELIMQLLEETPEEKQTTIA

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_002563
RefSeq Size 4200
RefSeq ORF 687
Synonyms HEL-S-303
Locus ID 5049
UniProt ID P68402
Cytogenetics 11q23.3
Summary Platelet-activating factor acetylhydrolase (PAFAH) inactivates platelet-activating factor (PAF) into acetate and LYSO-PAF. This gene encodes the beta subunit of PAFAH, the other subunits are alpha and gamma. Multiple alternatively spliced transcript variants have been described for this gene. [provided by RefSeq, Jan 2014]
Protein Pathways Ether lipid metabolism, Metabolic pathways
Write Your Own Review
You're reviewing:PAFAH1B2 (NM_002572) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC419243 PAFAH1B2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY419243 Transient overexpression lysate of platelet-activating factor acetylhydrolase 1b, catalytic subunit 2 (30kDa) (PAFAH1B2) 100 ug
$436.00
TP301313 Recombinant protein of human platelet-activating factor acetylhydrolase, isoform Ib, beta subunit 30kDa (PAFAH1B2), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP720217 Recombinant protein of human platelet-activating factor acetylhydrolase 1b, catalytic subunit 2 (30kDa) (PAFAH1B2), transcript variant 2. 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.