PAFAH1B2 (NM_002572) Human Tagged ORF Clone

SKU
RC201313
PAFAH1B2 (Myc-DDK-tagged)-Human platelet-activating factor acetylhydrolase 1b, catalytic subunit 2 (30kDa) (PAFAH1B2), transcript variant 1
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol PAFAH1B2
Synonyms HEL-S-303
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC201313 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGCCAAGGAGACTCAAACCCAGCAGCTATTCCGCATGCAGCAGAAGATATTCAAGGAGATGACCGAT
GGATGTCTCAGCACAACAGATTTGTTTTGGACTGTAAAGACAAAGAGCCTGATGTACTGTTCGTGGGAGA
CTCCATGGTGCAGTTAATGCAGCAATATGAGATATGGCGAGAGCTTTTTTCCCCACTTCATGCACTGAAT
TTTGGAATTGGGGGAGATACAACAAGACATGTTTTGTGGAGACTAAAGAATGGAGAACTGGAGAATATTA
AGCCTAAGGTCATTGTTGTCTGGGTAGGAACAAATAACCACGAAAATACAGCAGAAGAAGTAGCAGGTGG
GATCGAGGCCATTGTACAACTTATCAACACAAGGCAGCCACAGGCCAAAATCATTGTATTGGGTTTGTTA
CCTCGAGGTGAGAAACCCAATCCTTTGAGGCAAAAGAACGCCAAGGTGAACCAACTCCTCAAGGTTTCGC
TGCCGAAGCTTGCCAACGTGCAGCTCCTGGATACCGACGGGGGTTTTGTGCACTCGGACGGTGCCATCTC
CTGCCACGACATGTTTGATTTTCTGCATCTGACAGGAGGGGGCTATGCAAAGATCTGCAAACCCCTGCAT
GAACTGATCATGCAGTTGTTGGAGGAAACACCTGAGGAGAAACAAACCACCATTGCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC201313 protein sequence
Red=Cloning site Green=Tags(s)

MSQGDSNPAAIPHAAEDIQGDDRWMSQHNRFVLDCKDKEPDVLFVGDSMVQLMQQYEIWRELFSPLHALN
FGIGGDTTRHVLWRLKNGELENIKPKVIVVWVGTNNHENTAEEVAGGIEAIVQLINTRQPQAKIIVLGLL
PRGEKPNPLRQKNAKVNQLLKVSLPKLANVQLLDTDGGFVHSDGAISCHDMFDFLHLTGGGYAKICKPLH
ELIMQLLEETPEEKQTTIA

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_002572
ORF Size 687 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_002572.4
RefSeq Size 4200 bp
RefSeq ORF 690 bp
Locus ID 5049
UniProt ID P68402
Cytogenetics 11q23.3
Domains Lipase_GDSL
Protein Pathways Ether lipid metabolism, Metabolic pathways
MW 25.6 kDa
Summary Platelet-activating factor acetylhydrolase (PAFAH) inactivates platelet-activating factor (PAF) into acetate and LYSO-PAF. This gene encodes the beta subunit of PAFAH, the other subunits are alpha and gamma. Multiple alternatively spliced transcript variants have been described for this gene. [provided by RefSeq, Jan 2014]
Write Your Own Review
You're reviewing:PAFAH1B2 (NM_002572) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC201313L1 Lenti ORF clone of Human platelet-activating factor acetylhydrolase 1b, catalytic subunit 2 (30kDa) (PAFAH1B2), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC201313L2 Lenti ORF clone of Human platelet-activating factor acetylhydrolase 1b, catalytic subunit 2 (30kDa) (PAFAH1B2), transcript variant 1, mGFP tagged 10 ug
$600.00
RC201313L3 Lenti ORF clone of Human platelet-activating factor acetylhydrolase 1b, catalytic subunit 2 (30kDa) (PAFAH1B2), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC201313L4 Lenti ORF clone of Human platelet-activating factor acetylhydrolase 1b, catalytic subunit 2 (30kDa) (PAFAH1B2), transcript variant 1, mGFP tagged 10 ug
$600.00
RG201313 PAFAH1B2 (tGFP-tagged) - Human platelet-activating factor acetylhydrolase 1b, catalytic subunit 2 (30kDa) (PAFAH1B2), transcript variant 1 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC118559 PAFAH1B2 (untagged)-Human platelet-activating factor acetylhydrolase 1b, catalytic subunit 2 (30kDa) (PAFAH1B2), transcript variant 1 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.