ISG15 (NM_005101) Human Mass Spec Standard

SKU PH301235

ISG15 MS Standard C13 and N15-labeled recombinant protein (NP_005092)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC201235]
• Predicted MW: 17.9 kDa
• Protein Sequence:
  Protein Sequence

  >RC201235 protein sequence; Red=Cloning site Green=Tags(s); ; MGWDLTVKMLAGNEFQVSLSSSMSVSELKAQITQKIGVHAFQQRLAVHPSGVALQDRVPLASQGLGPGST; VLLVVDKCDEPLNILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPLGEY; GLKPLSTVFMNLRLRGGGTEPGGRS; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_005092
• RefSeq Size: 685
• RefSeq ORF: 495
• Synonyms: G1P2; hUCRP; IFI15; IMD38; IP17; UCRP
• Locus ID: 9636
• UniProt ID: P05161
• Cytogenetics: 1p36.33
• Summary: The protein encoded by this gene is a ubiquitin-like protein that is conjugated to intracellular target proteins upon activation by interferon-alpha and interferon-beta. Several functions have been ascribed to the encoded protein, including chemotactic activity towards neutrophils, direction of ligated target proteins to intermediate filaments, cell-to-cell signaling, and antiviral activity during viral infections. While conjugates of this protein have been found to be noncovalently attached to intermediate filaments, this protein is sometimes secreted. [provided by RefSeq, Dec 2012]
• Protein Families: Druggable Genome, Secreted Protein
• Protein Pathways: RIG-I-like receptor signaling pathway