ISG15 (NM_005101) Human Tagged ORF Clone

SKU
RC201235
ISG15 (Myc-DDK-tagged)-Human ISG15 ubiquitin-like modifier (ISG15)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$289.00
In Stock*
Specifications
Product Data
Target Symbol ISG15
Synonyms G1P2; hUCRP; IFI15; IMD38; IP17; UCRP
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC201235 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGCTGGGACCTGACGGTGAAGATGCTGGCGGGCAACGAATTCCAGGTGTCCCTGAGCAGCTCCATGT
CGGTGTCAGAGCTGAAGGCGCAGATCACCCAGAAGATCGGCGTGCACGCCTTCCAGCAGCGTCTGGCTGT
CCACCCGAGCGGTGTGGCGCTGCAGGACAGGGTCCCCCTTGCCAGCCAGGGCCTGGGCCCCGGCAGCACG
GTCCTGCTGGTGGTGGACAAATGCGACGAACCTCTGAACATCCTGGTGAGGAATAACAAGGGCCGCAGCA
GCACCTACGAGGTGCGGCTGACGCAGACCGTGGCCCACCTGAAGCAGCAAGTGAGCGGGCTGGAGGGTGT
GCAGGACGACCTGTTCTGGCTGACCTTCGAGGGGAAGCCCCTGGAGGACCAGCTCCCGCTGGGGGAGTAC
GGCCTCAAGCCCCTGAGCACCGTGTTCATGAATCTGCGCCTGCGGGGAGGCGGCACAGAGCCTGGCGGGC
GGAGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC201235 protein sequence
Red=Cloning site Green=Tags(s)

MGWDLTVKMLAGNEFQVSLSSSMSVSELKAQITQKIGVHAFQQRLAVHPSGVALQDRVPLASQGLGPGST
VLLVVDKCDEPLNILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPLGEY
GLKPLSTVFMNLRLRGGGTEPGGRS

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_005101
ORF Size 495 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Reference Data
RefSeq NM_005101.4
RefSeq Size 685 bp
RefSeq ORF 498 bp
Locus ID 9636
UniProt ID P05161
Cytogenetics 1p36.33
Domains UBQ
Protein Families Druggable Genome, Secreted Protein
Protein Pathways RIG-I-like receptor signaling pathway
MW 17.9 kDa
Summary The protein encoded by this gene is a ubiquitin-like protein that is conjugated to intracellular target proteins upon activation by interferon-alpha and interferon-beta. Several functions have been ascribed to the encoded protein, including chemotactic activity towards neutrophils, direction of ligated target proteins to intermediate filaments, cell-to-cell signaling, and antiviral activity during viral infections. While conjugates of this protein have been found to be noncovalently attached to intermediate filaments, this protein is sometimes secreted. [provided by RefSeq, Dec 2012]
Write Your Own Review
You're reviewing:ISG15 (NM_005101) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC201235L1 Lenti ORF clone of Human ISG15 ubiquitin-like modifier (ISG15), Myc-DDK-tagged 10 ug
$450.00
RC201235L2 Lenti ORF clone of Human ISG15 ubiquitin-like modifier (ISG15), mGFP tagged 10 ug
$450.00
RC201235L3 Lenti ORF clone of Human ISG15 ubiquitin-like modifier (ISG15), Myc-DDK-tagged 10 ug
$450.00
RC201235L4 Lenti ORF clone of Human ISG15 ubiquitin-like modifier (ISG15), mGFP tagged 10 ug
$450.00
RG201235 ISG15 (tGFP-tagged) - Human ISG15 ubiquitin-like modifier (ISG15) 10 ug
$489.00
SC116926 ISG15 (untagged)-Human ISG15 ubiquitin-like modifier (ISG15) 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.