OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

NCF1 (NM_000265) Human Mass Spec Standard

Be the first to review this product
SKU
PH301233
NCF1 MS Standard C13 and N15-labeled recombinant protein (NP_000256)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA302677 Goat Polyclonal Antibody against NCF1 / p47phox
100 ug
$565.00
LY400103 Transient overexpression lysate of neutrophil cytosolic factor 1 (NCF1) (as WB positive control) 100 ug
$436.00

Other products for "NCF1 or NM_000265"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC201233
Predicted MW 44.5 kDa
Protein Sequence
Protein Sequence
>RC201233 representing NM_000265
Red=Cloning site Green=Tags(s)

MGDTFIRHIALLGFEKRFVPSQHYVYMFLVKWQDLSEKVVYRRFTEIYEFHKTLKEMFPIEAGAINPENR
IIPHLPAPKWFDGQRAAENRQGTLTEYCSTLMSLPTKISRCPHLLDFFKVRPDDLKLPTDNQTKKPETYL
MPKDGKSTATDITGPIILQTYRAIANYEKTSGSEMALSTGDVVEVVEKSESGWWFCQMKAKRGWIPASFL
EPLDSPDETEDPEPNYAGEPYVAIKAYTAVEGDEVSLLEGEAVEVIHKLLDGWWVIRKDDVTGYFPSMYL
QKSGQDVSQAQRQIKRGAPPRRSSIRNAHSIHQRSRKRLSQDAYRRNSVRFLQQRRRQARPGPQSPGSPL
EEERQTQRSKPQPAVPPRPSADLILNRCSESTKRKLASPV

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_000256
RefSeq Size 1409
RefSeq ORF 1170
Synonyms CGD1; NCF1A; NOXO2; p47phox; SH3PXD1A
Locus ID 653361
UniProt ID P14598
Cytogenetics 7q11.23
Summary The protein encoded by this gene is a 47 kDa cytosolic subunit of neutrophil NADPH oxidase. This oxidase is a multicomponent enzyme that is activated to produce superoxide anion. Mutations in this gene have been associated with chronic granulomatous disease. provided by RefSeq, Jul 2008
Protein Pathways Chemokine signaling pathway, Fc gamma R-mediated phagocytosis, Leukocyte transendothelial migration, Pathogenic Escherichia coli infection, Regulation of actin cytoskeleton
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "NCF1" proteins (4)
SKU Description Size Price
LC400103 Lyophilized NCF1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400103 Transient overexpression lysate of neutrophil cytosolic factor 1 (NCF1) (as WB positive control) 100 ug
$436.00
TP301233 Recombinant protein of human neutrophil cytosolic factor 1 (NCF1), 20 µg 20 ug
$867.00
TP761217 Purified recombinant protein of Human neutrophil cytosolic factor 1 (NCF1), full length, with N-terminal HIS tag, expressed in E. coli, 50ug 50 ug
$270.00

file-alt Citations

S-Glutathionylation of p47phox sustains superoxide generation in activated neutrophils
Nagarkoti, Dubey, Awasthi et al
Biochim. Biophys. Acta (2018) 1865 (2), 444-454 DOI: 10.1016/j.bbamcr.2017.11.014
Snippet: Co. (MO, USA). NCF1 (NM_000265) Purified Human Protein was obtained from Origene Inc. 2.1. Isolation and purification of neutrophils. Human neutrophils were isolated from peripheral blood, obtained from healthy donors
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products