NCF1 (NM_000265) Human Mass Spec Standard

SKU
PH301233
NCF1 MS Standard C13 and N15-labeled recombinant protein (NP_000256)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC201233]
Predicted MW 44.5 kDa
Protein Sequence
Protein Sequence
>RC201233 representing NM_000265
Red=Cloning site Green=Tags(s)

MGDTFIRHIALLGFEKRFVPSQHYVYMFLVKWQDLSEKVVYRRFTEIYEFHKTLKEMFPIEAGAINPENR
IIPHLPAPKWFDGQRAAENRQGTLTEYCSTLMSLPTKISRCPHLLDFFKVRPDDLKLPTDNQTKKPETYL
MPKDGKSTATDITGPIILQTYRAIANYEKTSGSEMALSTGDVVEVVEKSESGWWFCQMKAKRGWIPASFL
EPLDSPDETEDPEPNYAGEPYVAIKAYTAVEGDEVSLLEGEAVEVIHKLLDGWWVIRKDDVTGYFPSMYL
QKSGQDVSQAQRQIKRGAPPRRSSIRNAHSIHQRSRKRLSQDAYRRNSVRFLQQRRRQARPGPQSPGSPL
EEERQTQRSKPQPAVPPRPSADLILNRCSESTKRKLASPV

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_000256
RefSeq Size 1409
RefSeq ORF 1170
Synonyms CGD1; NCF1A; NOXO2; p47phox; SH3PXD1A
Locus ID 653361
UniProt ID P14598
Cytogenetics 7q11.23
Summary The protein encoded by this gene is a 47 kDa cytosolic subunit of neutrophil NADPH oxidase. This oxidase is a multicomponent enzyme that is activated to produce superoxide anion. Mutations in this gene have been associated with chronic granulomatous disease. [provided by RefSeq, Jul 2008]
Protein Pathways Chemokine signaling pathway, Fc gamma R-mediated phagocytosis, Leukocyte transendothelial migration, Pathogenic Escherichia coli infection, Regulation of actin cytoskeleton
Write Your Own Review
You're reviewing:NCF1 (NM_000265) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC400103 NCF1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY400103 Transient overexpression lysate of neutrophil cytosolic factor 1 (NCF1) 100 ug
$436.00
TP301233 Recombinant protein of human neutrophil cytosolic factor 1 (NCF1), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP761217 Purified recombinant protein of Human neutrophil cytosolic factor 1 (NCF1), full length, with N-terminal HIS tag, expressed in E. coli, 50ug 50 ug
$261.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.