DLST (NM_001933) Human Mass Spec Standard

SKU
PH301220
DLST MS Standard C13 and N15-labeled recombinant protein (NP_001924)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC201220]
Predicted MW 48.6 kDa
Protein Sequence
Protein Sequence
>RC201220 representing NM_001933
Red=Cloning site Green=Tags(s)

MLSRSRCVSRAFSRSLSAFQKGNCPLGRRSLPGVSLCQGPGYPNSRKVVINNSVFSVRFFRTTAVCKDDL
VTVKTPAFAESVTEGDVRWEKAVGDTVAEDEVVCEIETDKTSVQVPSPANGVIEALLVPDGGKVEGGTPL
FTLRKTGAAPAKAKPAEAPAAAAPKAEPTAAAVPPPAAPIPTQMPPVPSPSQPPSGKPVSAVKPTVAPPL
AEPGAGKGLRSEHREKMNRMRQRIAQRLKEAQNTCAMLTTFNEIDMSNIQEMRARHKEAFLKKHNLKLGF
MSAFVKASAFALQEQPVVNAVIDDTTKEVVYRDYIDISVAVATPRGLVVPVIRNVEAMNFADIERTITEL
GEKARKNELAIEDMDGGTFTISNGGVFGSLFGTPIINPPQSAILGMHGIFDRPVAIGGKVEVRPMMYVAL
TYDHRLIDGREAVTFLRKIKAAVEDPRVLLLDL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001924
RefSeq Size 2828
RefSeq ORF 1359
Synonyms DLTS; KGD2; PGL7
Locus ID 1743
UniProt ID P36957
Cytogenetics 14q24.3
Summary This gene encodes a mitochondrial protein that belongs to the 2-oxoacid dehydrogenase family. This protein is one of the three components (the E2 component) of the 2-oxoglutarate dehydrogenase complex that catalyzes the overall conversion of 2-oxoglutarate to succinyl-CoA and CO(2). Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Oct 2011]
Protein Pathways Citrate cycle (TCA cycle), Lysine degradation, Metabolic pathways
Write Your Own Review
You're reviewing:DLST (NM_001933) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC419635 DLST HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY419635 Transient overexpression lysate of dihydrolipoamide S-succinyltransferase (E2 component of 2-oxo-glutarate complex) (DLST) 100 ug
$436.00
TP301220 Recombinant protein of human dihydrolipoamide S-succinyltransferase (E2 component of 2-oxo-glutarate complex) (DLST), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.