RBM42 (NM_024321) Human Mass Spec Standard

SKU
PH301202
RBM42 MS Standard C13 and N15-labeled recombinant protein (NP_077297)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC201202]
Predicted MW 50.4 kDa
Protein Sequence
Protein Sequence
>RC201202 protein sequence
Red=Cloning site Green=Tags(s)

MAGAGPAPGLPGAGGPVVPGPGAGIPGKSGEERLKEMEAEMALFEQEVLGAPVPGIPTAVPAVPTVPTVP
TVEAMQVPAAPVIRPIIATNTYQQVQQTLEARAAAAATVVPPMVGGPPFVGPVGFGPGDRSHLDSPEARE
AMFLRRAAVAPQRAPILRPAFVPHVLQRADSALSSAAAGPRPMALRPPHQALVGPPLPGPPGPPMMLPPM
ARAPGPPLGSMAALRPPLEEPAAPRELGLGLGLGLKEKEEAVVAAAAGLEEASAAVAVGAGGAPAGPAVI
GPSLPLALAMPLPEPEPLPLPLEVVRGLLPPLRIPELLSLRPRPRPPRPEPPPGLMALEVPEPLGEDKKK
GKPEKLKRCIRTAAGSSWEDPSLLEWDADDFRIFCGDLGNEVNDDILARAFSRFPSFLKAKVIRDKRTGK
TKGYGFVSFKDPSDYVRAMREMNGKYVGSRPIKLRKSMWKDRNLDVVRKKQKEKKKLGLR

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_077297
RefSeq Size 1669
RefSeq ORF 1440
Locus ID 79171
UniProt ID Q9BTD8
Cytogenetics 19q13.12
Summary Binds (via the RRM domain) to the 3'-untranslated region (UTR) of CDKN1A mRNA.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:RBM42 (NM_024321) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC411301 RBM42 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY411301 Transient overexpression lysate of RNA binding motif protein 42 (RBM42) 100 ug
$436.00
TP301202 Recombinant protein of human RNA binding motif protein 42 (RBM42), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.