RBM42 Rabbit Polyclonal Antibody

SKU TA343929

Rabbit Polyclonal Anti-RBM42 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-RBM42 antibody: synthetic peptide directed towards the C terminal of human RBM42. Synthetic peptide located within the following region: DPSDYVRAMREMNGKYVGSRPIKLRKSMWKDRNLDVVRKKQKEKKKLGLR
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 50 kDa
• Gene Name: RNA binding motif protein 42
• Database Link:
  NP_077297
  Q9BTD8
• Background: RBM42 belongs to the RRM RBM42 family and it contains 1 RRM (RNA recognition motif) domain. The functions of RBM42 remain unknown.
• Synonyms: MGC10433
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 86%

Reference Data