Perilipin 3 (PLIN3) (NM_005817) Human Mass Spec Standard

SKU
PH301193
PLIN3 MS Standard C13 and N15-labeled recombinant protein (NP_005808)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC201193]
Predicted MW 46.9 kDa
Protein Sequence
Protein Sequence
>RC201193 representing NM_005817
Red=Cloning site Green=Tags(s)

MSADGAEADGSTQVTVEEPVQQPSVVDRVASMPLISSTCDMVSAAYASTKESYPHIKTVCDAAEKGVRTL
TAAAVSGAQPILSKLEPQIASASEYAHRGLDKLEENLPILQQPTEKVLADTKELVSSKVSGAQEMVSSAK
DTVATQLSEAVDATRGAVQSGVDKTKSVVTGGVQSVMGSRLGQMVLSGVDTVLGKSEEWADNHLPLTDAE
LARIATSLDGFDVASVQQQRQEQSYFVRLGSLSERLRQHAYEHSLGKLRATKQRAQEALLQLSQALSLME
TVKQGVDQKLVEGQEKLHQMWLSWNQKQLQGPEKEPPKPEQVESRALTMFRDIAQQLQATCTSLGSSIQG
LPTNVKDQVQQARRQVEDLQATFSSIHSFQDLSSSILAQSRERVASAREALDHMVEYVAQNTPVTWLVGP
FAPGITEKAPEEKK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_005808
RefSeq Size 2241
RefSeq ORF 1302
Synonyms M6PRBP1; PP17; TIP47
Locus ID 10226
UniProt ID O60664
Cytogenetics 19p13.3
Summary Mannose 6-phophate receptors (MPRs) deliver lysosomal hydrolase from the Golgi to endosomes and then return to the Golgi complex. The protein encoded by this gene interacts with the cytoplasmic domains of both cation-independent and cation-dependent MPRs, and is required for endosome-to-Golgi transport. This protein also binds directly to the GTPase RAB9 (RAB9A), a member of the RAS oncogene family. The interaction with RAB9 has been shown to increase the affinity of this protein for its cargo. Multiple transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Aug 2009]
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:Perilipin 3 (PLIN3) (NM_005817) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC417051 PLIN3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC431367 PLIN3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY417051 Transient overexpression lysate of perilipin 3 (PLIN3), transcript variant 1 100 ug
$436.00
LY431367 Transient overexpression lysate of perilipin 3 (PLIN3), transcript variant 3 100 ug
$436.00
TP301193 Recombinant protein of human mannose-6-phosphate receptor binding protein 1 (M6PRBP1), 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.