OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PSMA7 (NM_002792) Human Mass Spec Standard

Be the first to review this product
SKU
PH301169
PSMA7 MS Standard C13 and N15-labeled recombinant protein (NP_002783)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA500694 Anti-PSMA7 mouse monoclonal antibody, clone OTI8F9 (formerly 8F9) 100 ul
$447.00
LY400987 Transient overexpression lysate of proteasome (prosome, macropain) subunit, alpha type, 7 (PSMA7) (as WB positive control) 100 ug
$436.00

Other products for "PSMA7 or NM_002792"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC201169
Predicted MW 27.9 kDa
Protein Sequence
Protein Sequence
>RC201169 protein sequence
Red=Cloning site Green=Tags(s)

MSYDRAITVFSPDGHLFQVEYAQEAVKKGSTAVGVRGRDIVVLGVEKKSVAKLQDERTVRKICALDDNVC
MAFAGLTADARIVINRARVECQSHRLTVEDPVTVEYITRYIASLKQRYTQSNGRRPFGISALIVGFDFDG
TPRLYQTDPSGTYHAWKANAIGRGAKSVREFLEKNYTDEAIETDDLTIKLVIKALLEVVQSGGKNIELAV
MRRDQSLKILNPEEIEKYVAEIEKEKEENEKKKQKKAS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_002783
RefSeq Size 1050
RefSeq ORF 744
Synonyms C6; HEL-S-276; HSPC; RC6-1; XAPC7
Locus ID 5688
UniProt ID O14818
Cytogenetics 20q13.33
Summary The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. This gene encodes a member of the peptidase T1A family that functions as a 20S core alpha subunit. The encoded protein interacts with the hepatitis B virus X protein and plays a role in regulating hepatitis C virus internal ribosome entry site (IRES) activity, an activity essential for viral replication. The encoded protein also plays a role in the cellular stress response by regulating hypoxia-inducible factor-1alpha. A pseudogene of this gene is located on the long arm of chromosome 9. provided by RefSeq, Jul 2012
Protein Families Druggable Genome, Protease
Protein Pathways Proteasome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "PSMA7" proteins (3)
SKU Description Size Price
LC400987 Lyophilized PSMA7 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400987 Transient overexpression lysate of proteasome (prosome, macropain) subunit, alpha type, 7 (PSMA7) (as WB positive control) 100 ug
$436.00
TP301169 Recombinant protein of human proteasome (prosome, macropain) subunit, alpha type, 7 (PSMA7), 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products