PSMA7 (NM_002792) Human Tagged ORF Clone

SKU
RC201169
PSMA7 (Myc-DDK-tagged)-Human proteasome (prosome, macropain) subunit, alpha type, 7 (PSMA7)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$450.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol PSMA7
Synonyms C6; HEL-S-276; HSPC; RC6-1; XAPC7
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC201169 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGCTACGACCGCGCCATCACCGTCTTCTCGCCCGACGGCCACCTCTTCCAAGTGGAGTACGCGCAGG
AGGCCGTCAAGAAGGGCTCGACCGCGGTTGGTGTTCGAGGAAGAGACATTGTTGTTCTTGGTGTGGAGAA
GAAGTCAGTGGCCAAACTGCAGGATGAAAGAACAGTGCGGAAGATCTGTGCTTTGGATGACAACGTCTGC
ATGGCCTTTGCAGGCCTCACCGCCGATGCAAGGATAGTCATCAACAGGGCCCGGGTGGAGTGCCAGAGCC
ACCGGCTGACTGTGGAGGACCCGGTCACTGTGGAGTACATCACCCGCTACATCGCCAGTCTGAAGCAGCG
TTATACGCAGAGCAATGGGCGCAGGCCGTTTGGCATCTCTGCCCTCATCGTGGGTTTCGACTTTGATGGC
ACTCCTAGGCTCTATCAGACTGACCCCTCGGGCACATACCATGCCTGGAAGGCCAATGCCATAGGCCGGG
GTGCCAAGTCAGTGCGTGAGTTCCTGGAGAAGAACTATACTGACGAAGCCATTGAAACAGATGATCTGAC
CATTAAGCTGGTGATCAAGGCACTCCTGGAAGTGGTTCAGTCAGGTGGCAAAAACATTGAACTTGCTGTC
ATGAGGCGAGATCAATCCCTCAAGATTTTAAATCCTGAAGAAATTGAGAAGTATGTTGCTGAAATTGAAA
AAGAAAAAGAAGAAAACGAAAAGAAGAAACAAAAGAAAGCATCA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC201169 protein sequence
Red=Cloning site Green=Tags(s)

MSYDRAITVFSPDGHLFQVEYAQEAVKKGSTAVGVRGRDIVVLGVEKKSVAKLQDERTVRKICALDDNVC
MAFAGLTADARIVINRARVECQSHRLTVEDPVTVEYITRYIASLKQRYTQSNGRRPFGISALIVGFDFDG
TPRLYQTDPSGTYHAWKANAIGRGAKSVREFLEKNYTDEAIETDDLTIKLVIKALLEVVQSGGKNIELAV
MRRDQSLKILNPEEIEKYVAEIEKEKEENEKKKQKKAS

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_002792
ORF Size 744 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_002792.4
RefSeq Size 1050 bp
RefSeq ORF 747 bp
Locus ID 5688
UniProt ID O14818
Cytogenetics 20q13.33
Domains proteasome
Protein Families Druggable Genome, Protease
Protein Pathways Proteasome
MW 27.9 kDa
Summary The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. This gene encodes a member of the peptidase T1A family that functions as a 20S core alpha subunit. The encoded protein interacts with the hepatitis B virus X protein and plays a role in regulating hepatitis C virus internal ribosome entry site (IRES) activity, an activity essential for viral replication. The encoded protein also plays a role in the cellular stress response by regulating hypoxia-inducible factor-1alpha. A pseudogene of this gene is located on the long arm of chromosome 9. [provided by RefSeq, Jul 2012]
Write Your Own Review
You're reviewing:PSMA7 (NM_002792) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC201169L1 Lenti ORF clone of Human proteasome (prosome, macropain) subunit, alpha type, 7 (PSMA7), Myc-DDK-tagged 10 ug
$750.00
RC201169L2 Lenti ORF clone of Human proteasome (prosome, macropain) subunit, alpha type, 7 (PSMA7), mGFP tagged 10 ug
$750.00
RC201169L3 Lenti ORF clone of Human proteasome (prosome, macropain) subunit, alpha type, 7 (PSMA7), Myc-DDK-tagged 10 ug
$750.00
RC201169L4 Lenti ORF clone of Human proteasome (prosome, macropain) subunit, alpha type, 7 (PSMA7), mGFP tagged 10 ug
$750.00
RG201169 PSMA7 (tGFP-tagged) - Human proteasome (prosome, macropain) subunit, alpha type, 7 (PSMA7) 10 ug
$650.00
SC319465 PSMA7 (untagged)-Human proteasome (prosome, macropain) subunit, alpha type, 7 (PSMA7) 10 ug
$450.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.