CDC42EP4 (NM_012121) Human Mass Spec Standard

SKU
PH301162
CDC42EP4 MS Standard C13 and N15-labeled recombinant protein (NP_036253)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC201162]
Predicted MW 38 kDa
Protein Sequence
Protein Sequence
>RC201162 protein sequence
Red=Cloning site Green=Tags(s)

MPILKQLVSSSVHSKRRSRADLTAEMISAPLGDFRHTMHVGRAGDAFGDTSFLNSKAGEPDGESLDEQPS
SSSSKRSLLSRKFRGSKRSQSVTRGEREQRDMLGSLRDSALFVKNAMSLPQLNEKEAAEKGTSKLPKSLS
SSPVKKANDGEGGDEEAGTEEAVPRRNGAAGPHSPDPLLDEQAFGDLTDLPVVPKATYGLKHAESIMSFH
IDLGPSMLGDVLSIMDKEEWDPEEGEGGYHGDEGAAGTITQAPPYAVAAPPLARQEGKAGPDLPSLPSHA
LEDEGWAAAAPSPGSARSMGSHTTRDSSSLSSCTSGILEERSPAFRGPDRARAAVSRQPDKEFSFMDEEE
EDEIRV

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_036253
RefSeq Size 3121
RefSeq ORF 1068
Synonyms BORG4; CEP4; KAIA1777
Locus ID 23580
UniProt ID Q9H3Q1
Cytogenetics 17q25.1
Summary The product of this gene is a member of the CDC42-binding protein family. Members of this family interact with Rho family GTPases and regulate the organization of the actin cytoskeleton. This protein has been shown to bind both CDC42 and TC10 GTPases in a GTP-dependent manner. When overexpressed in fibroblasts, this protein was able to induce pseudopodia formation, which suggested a role in inducing actin filament assembly and cell shape control. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:CDC42EP4 (NM_012121) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC415972 CDC42EP4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY415972 Transient overexpression lysate of CDC42 effector protein (Rho GTPase binding) 4 (CDC42EP4) 100 ug
$436.00
TP301162 Recombinant protein of human CDC42 effector protein (Rho GTPase binding) 4 (CDC42EP4), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.