p19 INK4d (CDKN2D) (NM_079421) Human Mass Spec Standard

SKU
PH301155
CDKN2D MS Standard C13 and N15-labeled recombinant protein (NP_524145)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC201155]
Predicted MW 17.7 kDa
Protein Sequence
Protein Sequence
>RC201155 protein sequence
Red=Cloning site Green=Tags(s)

MLLEEVRAGDRLSGAAARGDVQEVRRLLHRELVHPDALNRFGKTALQVMMFGSTAIALELLKQGASPNVQ
DTSGTSPVHDAARTGFLDTLKVLVEHGADVNVPDGTGALPIHLAVQEGHTAVVSFLAAESDLHRRDARGL
TPLELALQRGAQDLVDILQGHMVAPL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_524145
RefSeq Size 1162
RefSeq ORF 498
Synonyms INK4D; p19; p19-INK4D
Locus ID 1032
UniProt ID P55273
Cytogenetics 19p13.2
Summary The protein encoded by this gene is a member of the INK4 family of cyclin-dependent kinase inhibitors. This protein has been shown to form a stable complex with CDK4 or CDK6, and prevent the activation of the CDK kinases, thus function as a cell growth regulator that controls cell cycle G1 progression. The abundance of the transcript of this gene was found to oscillate in a cell-cycle dependent manner with the lowest expression at mid G1 and a maximal expression during S phase. The negative regulation of the cell cycle involved in this protein was shown to participate in repressing neuronal proliferation, as well as spermatogenesis. Two alternatively spliced variants of this gene, which encode an identical protein, have been reported. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome
Protein Pathways Cell cycle
Write Your Own Review
You're reviewing:p19 INK4d (CDKN2D) (NM_079421) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH314065 CDKN2D MS Standard C13 and N15-labeled recombinant protein (NP_001791) 10 ug
$3,255.00
LC400682 CDKN2D HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC409201 CDKN2D HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY400682 Transient overexpression lysate of cyclin-dependent kinase inhibitor 2D (p19, inhibits CDK4) (CDKN2D), transcript variant 1 100 ug
$436.00
LY409201 Transient overexpression lysate of cyclin-dependent kinase inhibitor 2D (p19, inhibits CDK4) (CDKN2D), transcript variant 2 100 ug
$436.00
TP301155 Recombinant protein of human cyclin-dependent kinase inhibitor 2D (p19, inhibits CDK4) (CDKN2D), transcript variant 2, 20 µg 20 ug
$737.00
TP314065 Recombinant protein of human cyclin-dependent kinase inhibitor 2D (p19, inhibits CDK4) (CDKN2D), transcript variant 1, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.