p19 INK4d (CDKN2D) (NM_079421) Human Tagged ORF Clone

SKU
RC201155
CDKN2D (Myc-DDK-tagged)-Human cyclin-dependent kinase inhibitor 2D (p19, inhibits CDK4) (CDKN2D), transcript variant 2
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$225.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol p19 INK4d
Synonyms INK4D; p19; p19-INK4D
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC201155 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCTGCTGGAGGAGGTTCGCGCCGGCGACCGGCTGAGTGGGGCGGCGGCCCGGGGCGACGTGCAGGAGG
TGCGCCGCCTTCTGCACCGCGAGCTGGTGCATCCCGACGCCCTCAACCGCTTCGGCAAGACGGCGCTGCA
GGTCATGATGTTTGGCAGCACCGCCATCGCCCTGGAGCTGCTGAAGCAAGGTGCCAGCCCCAATGTCCAG
GACACCTCCGGTACCAGTCCAGTCCATGACGCAGCCCGCACTGGATTCCTGGACACCCTGAAGGTCCTAG
TGGAGCACGGGGCTGATGTCAACGTGCCTGATGGCACCGGGGCACTTCCAATCCATCTGGCAGTTCAAGA
GGGTCACACTGCTGTGGTCAGCTTTCTGGCAGCTGAATCTGATCTCCATCGCAGGGACGCCAGGGGTCTC
ACACCCTTGGAGCTGGCACTGCAGAGAGGGGCTCAGGACCTCGTGGACATCCTGCAGGGCCACATGGTGG
CCCCGCTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC201155 protein sequence
Red=Cloning site Green=Tags(s)

MLLEEVRAGDRLSGAAARGDVQEVRRLLHRELVHPDALNRFGKTALQVMMFGSTAIALELLKQGASPNVQ
DTSGTSPVHDAARTGFLDTLKVLVEHGADVNVPDGTGALPIHLAVQEGHTAVVSFLAAESDLHRRDARGL
TPLELALQRGAQDLVDILQGHMVAPL

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_079421
ORF Size 498 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_079421.2, NP_524145.1
RefSeq Size 1162 bp
RefSeq ORF 501 bp
Locus ID 1032
UniProt ID P55273
Cytogenetics 19p13.2
Protein Families Druggable Genome
Protein Pathways Cell cycle
MW 17.7 kDa
Summary The protein encoded by this gene is a member of the INK4 family of cyclin-dependent kinase inhibitors. This protein has been shown to form a stable complex with CDK4 or CDK6, and prevent the activation of the CDK kinases, thus function as a cell growth regulator that controls cell cycle G1 progression. The abundance of the transcript of this gene was found to oscillate in a cell-cycle dependent manner with the lowest expression at mid G1 and a maximal expression during S phase. The negative regulation of the cell cycle involved in this protein was shown to participate in repressing neuronal proliferation, as well as spermatogenesis. Two alternatively spliced variants of this gene, which encode an identical protein, have been reported. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:p19 INK4d (CDKN2D) (NM_079421) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC201155L1 Lenti ORF clone of Human cyclin-dependent kinase inhibitor 2D (p19, inhibits CDK4) (CDKN2D), transcript variant 2, Myc-DDK-tagged 10 ug
$525.00
RC201155L2 Lenti ORF clone of Human cyclin-dependent kinase inhibitor 2D (p19, inhibits CDK4) (CDKN2D), transcript variant 2, mGFP tagged 10 ug
$525.00
RC201155L3 Lenti ORF clone of Human cyclin-dependent kinase inhibitor 2D (p19, inhibits CDK4) (CDKN2D), transcript variant 2, Myc-DDK-tagged 10 ug
$525.00
RC201155L4 Lenti ORF clone of Human cyclin-dependent kinase inhibitor 2D (p19, inhibits CDK4) (CDKN2D), transcript variant 2, mGFP tagged 10 ug
$525.00
RG201155 CDKN2D (tGFP-tagged) - Human cyclin-dependent kinase inhibitor 2D (p19, inhibits CDK4) (CDKN2D), transcript variant 2 10 ug
$425.00
SC120263 CDKN2D (untagged)-Human cyclin-dependent kinase inhibitor 2D (p19, inhibits CDK4) (CDKN2D), transcript variant 2 10 ug
$450.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.