Protein Phosphatase 1 beta (PPP1CB) (NM_206876) Human Mass Spec Standard

SKU PH301142

PPP1CB MS Standard C13 and N15-labeled recombinant protein (NP_996759)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC201142]
• Predicted MW: 37.2 kDa
• Protein Sequence:
  Protein Sequence

  >RC201142 protein sequence; Red=Cloning site Green=Tags(s); ; MADGELNVDSLITRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKICGDIHGQYTD; LLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECK; RRFNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDTGLLCDLLWSDPDK; DVQGWGENDRGVSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGG; MMSVDETLMCSFQILKPSEKKAKYQYGGLNSGRPVTPPRTANPPKKR; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_996759
• RefSeq Size: 4786
• RefSeq ORF: 981
• Synonyms: HEL-S-80p; MP; NSLH2; PP-1B; PP1B; PP1beta; PP1c; PPP1beta; PPP1CD
• Locus ID: 5500
• UniProt ID: P62140
• Cytogenetics: 2p23.2
• Summary: The protein encoded by this gene is one of the three catalytic subunits of protein phosphatase 1 (PP1). PP1 is a serine/threonine specific protein phosphatase known to be involved in the regulation of a variety of cellular processes, such as cell division, glycogen metabolism, muscle contractility, protein synthesis, and HIV-1 viral transcription. Mouse studies suggest that PP1 functions as a suppressor of learning and memory. Two alternatively spliced transcript variants encoding distinct isoforms have been observed. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome, Phosphatase
• Protein Pathways: Focal adhesion, Insulin signaling pathway, Long-term potentiation, Oocyte meiosis, Regulation of actin cytoskeleton, Vascular smooth muscle contraction