Protein Phosphatase 1 beta (PPP1CB) (NM_206876) Human Tagged ORF Clone

  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

SKU
RC201142
PPP1CB (Myc-DDK-tagged)-Human protein phosphatase 1, catalytic subunit, beta isozyme (PPP1CB), transcript variant 3
$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol Protein Phosphatase 1 beta
Synonyms HEL-S-80p; MP; NSLH2; PP-1B; PP1B; PP1beta; PP1c; PPP1beta; PPP1CD
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC201142 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGACGGGGAGCTGAACGTGGACAGCCTCATCACCCGGCTGCTGGAGGTACGAGGATGTCGTCCAG
GAAAGATTGTGCAGATGACTGAAGCAGAAGTTCGAGGCTTATGTATCAAGTCTCGGGAGATCTTTCTCAG
CCAGCCTATTCTTTTGGAATTGGAAGCACCGCTGAAAATTTGTGGAGATATTCATGGACAGTATACAGAT
TTACTGAGATTATTTGAATATGGAGGTTTCCCACCAGAAGCCAACTATCTTTTCTTAGGAGATTATGTGG
ACAGAGGAAAGCAGTCTTTGGAAACCATTTGTTTGCTATTGGCTTATAAAATCAAATATCCAGAGAACTT
CTTTCTCTTAAGAGGAAACCATGAGTGTGCTAGCATCAATCGCATTTATGGATTCTATGATGAATGCAAA
CGAAGATTTAATATTAAATTGTGGAAGACCTTCACTGATTGTTTTAACTGTCTGCCTATAGCAGCCATTG
TGGATGAGAAGATCTTCTGTTGTCATGGAGGATTGTCACCAGACCTGCAATCTATGGAGCAGATTCGGAG
AATTATGAGACCTACTGATGTCCCTGATACAGGTTTGCTCTGTGATTTGCTATGGTCTGATCCAGATAAG
GATGTGCAAGGCTGGGGAGAAAATGATCGTGGTGTTTCCTTTACTTTTGGAGCTGATGTAGTCAGTAAAT
TTCTGAATCGTCATGATTTAGATTTGATTTGTCGAGCTCATCAGGTGGTGGAAGATGGATATGAATTTTT
TGCTAAACGACAGTTGGTAACCTTATTTTCAGCCCCAAATTACTGTGGCGAGTTTGATAATGCTGGTGGA
ATGATGAGTGTGGATGAAACTTTGATGTGTTCATTTCAGATATTGAAACCATCTGAAAAGAAAGCTAAAT
ACCAGTATGGTGGACTGAATTCTGGACGTCCTGTCACTCCACCTCGAACAGCTAATCCGCCGAAGAAAAG
G


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC201142 protein sequence
Red=Cloning site Green=Tags(s)

MADGELNVDSLITRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKICGDIHGQYTD
LLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECK
RRFNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDTGLLCDLLWSDPDK
DVQGWGENDRGVSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGG
MMSVDETLMCSFQILKPSEKKAKYQYGGLNSGRPVTPPRTANPPKKR

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_206876
ORF Size 981 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_206876.1, NP_996759.1
RefSeq Size 4786 bp
RefSeq ORF 984 bp
Locus ID 5500
UniProt ID P62140
Cytogenetics 2p23.2
Protein Families Druggable Genome, Phosphatase
Protein Pathways Focal adhesion, Insulin signaling pathway, Long-term potentiation, Oocyte meiosis, Regulation of actin cytoskeleton, Vascular smooth muscle contraction
MW 37.2 kDa
Summary The protein encoded by this gene is one of the three catalytic subunits of protein phosphatase 1 (PP1). PP1 is a serine/threonine specific protein phosphatase known to be involved in the regulation of a variety of cellular processes, such as cell division, glycogen metabolism, muscle contractility, protein synthesis, and HIV-1 viral transcription. Mouse studies suggest that PP1 functions as a suppressor of learning and memory. Two alternatively spliced transcript variants encoding distinct isoforms have been observed. [provided by RefSeq, Jul 2008]
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

SKU Description Size Price
RC201142L1 Lenti ORF clone of Human protein phosphatase 1, catalytic subunit, beta isozyme (PPP1CB), transcript variant 3, Myc-DDK-tagged 10 ug
$600.00
RC201142L2 Lenti ORF clone of Human protein phosphatase 1, catalytic subunit, beta isozyme (PPP1CB), transcript variant 3, mGFP tagged 10 ug
$600.00
RC201142L3 Lenti ORF clone of Human protein phosphatase 1, catalytic subunit, beta isozyme (PPP1CB), transcript variant 3, Myc-DDK-tagged 10 ug
$600.00
RC201142L4 Lenti ORF clone of Human protein phosphatase 1, catalytic subunit, beta isozyme (PPP1CB), transcript variant 3, mGFP tagged 10 ug
$600.00
RG201142 PPP1CB (tGFP-tagged) - Human protein phosphatase 1, catalytic subunit, beta isozyme (PPP1CB), transcript variant 3 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC127982 PPP1CB (untagged)-Human protein phosphatase 1, catalytic subunit, beta isozyme (PPP1CB), transcript variant 3 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.