MSI2 (NM_138962) Human Mass Spec Standard

SKU
PH301003
MSI2 MS Standard C13 and N15-labeled recombinant protein (NP_620412)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC201003]
Predicted MW 35.2 kDa
Protein Sequence
Protein Sequence
>RC201003 protein sequence
Red=Cloning site Green=Tags(s)

MEANGSQGTSGSANDSQHDPGKMFIGGLSWQTSPDSLRDYFSKFGEIRECMVMRDPTTKRSRGFGFVTFA
DPASVDKVLGQPHHELDSKTIDPKVAFPRRAQPKMVTRTKKIFVGGLSANTVVEDVKQYFEQFGKVEDAM
LMFDKTTNRHRGFGFVTFENEDVVEKVCEIHFHEINNKMVECKKAQPKEVMFPPGTRGRARGLPYTMDAF
MLGMGMLGYPNFVATYGRGYPGFAPSYGYQFPGFPAAAYGPVAAAAVAAARGSGSNPARPGGFPGANSPG
PVADLYGPASQDSGVGNYISAASPQPGSGFGHGIAGPLIATAFTNGYH

SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_620412
RefSeq Size 1581
RefSeq ORF 984
Synonyms MSI2H
Locus ID 124540
UniProt ID Q96DH6
Cytogenetics 17q22
Summary This gene encodes an RNA-binding protein that is a member of the Musashi protein family. The encoded protein is transcriptional regulator that targets genes involved in development and cell cycle regulation. Mutations in this gene are associated with poor prognosis in certain types of cancers. This gene has also been shown to be rearranged in certain cancer cells. [provided by RefSeq, Apr 2016]
Write Your Own Review
You're reviewing:MSI2 (NM_138962) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC403371 MSI2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC406896 MSI2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY403371 Transient overexpression lysate of musashi homolog 2 (Drosophila) (MSI2), transcript variant 1 100 ug
$436.00
LY406896 Transient overexpression lysate of musashi homolog 2 (Drosophila) (MSI2), transcript variant 2 100 ug
$436.00
TP301003 Recombinant protein of human musashi homolog 2 (Drosophila) (MSI2), transcript variant 1, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.