OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

SF3B5 (NM_031287) Human Mass Spec Standard

Be the first to review this product
SKU
PH300977
SF3B5 MS Standard C13 and N15-labeled recombinant protein (NP_112577)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA343080 Rabbit Polyclonal Anti-SF3B5 Antibody
100 ul
$585.00
LY410578 Transient overexpression lysate of splicing factor 3b, subunit 5, 10kDa (SF3B5) (as WB positive control) 100 ug
$436.00

Other products for "SF3B5 or NM_031287"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC200977
Predicted MW 10.1 kDa
Protein Sequence
Protein Sequence
>RC200977 protein sequence
Red=Cloning site Green=Tags(s)

MTDRYTIHSQLEHLQSKYIGTGHADTTKWEWLVNQHRDSYCSYMGHFDLLNYFAIAENESKARVRFNLME
KMLQPCGPPADKPEEN

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_112577
RefSeq Size 786
RefSeq ORF 258
Synonyms SF3b10; Ysf3
Locus ID 83443
UniProt ID Q9BWJ5
Cytogenetics 6q24.2
Summary Involved in pre-mRNA splicing as a component of the splicing factor SF3B complex, a constituent of the spliceosome (PubMed:27720643, PubMed:28781166). SF3B complex is required for 'A' complex assembly formed by the stable binding of U2 snRNP to the branchpoint sequence (BPS) in pre-mRNA. Sequence independent binding of SF3A/SF3B complex upstream of the branch site is essential, it may anchor U2 snRNP to the pre-mRNA (PubMed:12234937).UniProtKB/Swiss-Prot Function
Protein Pathways Spliceosome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "SF3B5" proteins (3)
SKU Description Size Price
LC410578 Lyophilized SF3B5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY410578 Transient overexpression lysate of splicing factor 3b, subunit 5, 10kDa (SF3B5) (as WB positive control) 100 ug
$436.00
TP300977 Recombinant protein of human splicing factor 3b, subunit 5, 10kDa (SF3B5), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products