SF3B5 (NM_031287) Human Mass Spec Standard

SKU PH300977

SF3B5 MS Standard C13 and N15-labeled recombinant protein (NP_112577)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC200977]
• Predicted MW: 10.1 kDa
• Protein Sequence:
  Protein Sequence

  >RC200977 protein sequence; Red=Cloning site Green=Tags(s); ; MTDRYTIHSQLEHLQSKYIGTGHADTTKWEWLVNQHRDSYCSYMGHFDLLNYFAIAENESKARVRFNLME; KMLQPCGPPADKPEEN; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_112577
• RefSeq Size: 786
• RefSeq ORF: 258
• Synonyms: SF3b10; Ysf3
• Locus ID: 83443
• UniProt ID: Q9BWJ5
• Cytogenetics: 6q24.2
• Summary: Involved in pre-mRNA splicing as a component of the splicing factor SF3B complex, a constituent of the spliceosome (PubMed:27720643, PubMed:28781166). SF3B complex is required for 'A' complex assembly formed by the stable binding of U2 snRNP to the branchpoint sequence (BPS) in pre-mRNA. Sequence independent binding of SF3A/SF3B complex upstream of the branch site is essential, it may anchor U2 snRNP to the pre-mRNA (PubMed:12234937).[UniProtKB/Swiss-Prot Function]
• Protein Pathways: Spliceosome