SF3B5 (NM_031287) Human Tagged ORF Clone

SKU
RC200977
SF3B5 (Myc-DDK-tagged)-Human splicing factor 3b, subunit 5, 10kDa (SF3B5)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$150.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol SF3B5
Synonyms SF3b10; Ysf3
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC200977 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGACTGACCGCTACACCATCCATAGCCAGCTGGAGCACCTGCAGTCCAAGTACATCGGCACGGGCCACG
CCGACACCACCAAGTGGGAGTGGCTGGTGAACCAACACCGCGACTCGTACTGCTCCTACATGGGCCACTT
CGACCTTCTCAACTACTTCGCCATTGCGGAGAATGAGAGCAAAGCGCGAGTCCGCTTCAACTTGATGGAA
AAGATGCTTCAGCCTTGTGGACCGCCAGCCGACAAGCCCGAGGAGAAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC200977 protein sequence
Red=Cloning site Green=Tags(s)

MTDRYTIHSQLEHLQSKYIGTGHADTTKWEWLVNQHRDSYCSYMGHFDLLNYFAIAENESKARVRFNLME
KMLQPCGPPADKPEEN

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_031287
ORF Size 258 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_031287.3
RefSeq Size 786 bp
RefSeq ORF 261 bp
Locus ID 83443
UniProt ID Q9BWJ5
Cytogenetics 6q24.2
Protein Pathways Spliceosome
MW 10.1 kDa
Summary Involved in pre-mRNA splicing as a component of the splicing factor SF3B complex, a constituent of the spliceosome (PubMed:27720643, PubMed:28781166). SF3B complex is required for 'A' complex assembly formed by the stable binding of U2 snRNP to the branchpoint sequence (BPS) in pre-mRNA. Sequence independent binding of SF3A/SF3B complex upstream of the branch site is essential, it may anchor U2 snRNP to the pre-mRNA (PubMed:12234937).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:SF3B5 (NM_031287) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC200977L3 Lenti ORF clone of Human splicing factor 3b, subunit 5, 10kDa (SF3B5), Myc-DDK-tagged 10 ug
$450.00
RC200977L4 Lenti ORF clone of Human splicing factor 3b, subunit 5, 10kDa (SF3B5), mGFP tagged 10 ug
$450.00
RG200977 SF3B5 (tGFP-tagged) - Human splicing factor 3b, subunit 5, 10kDa (SF3B5) 10 ug
$489.00
SC107691 SF3B5 (untagged)-Human splicing factor 3b, subunit 5, 10kDa (SF3B5) 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.