ISG20L2 (NM_030980) Human Mass Spec Standard

SKU
PH300946
ISG20L2 MS Standard C13 and N15-labeled recombinant protein (NP_112242)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC200946]
Predicted MW 39.2 kDa
Protein Sequence
Protein Sequence
>RC200946 protein sequence
Red=Cloning site Green=Tags(s)

MSTLLLNLDFGEPPPKKALEGNAKHRNFVKKRRLLERRGFLSKKNQPPSKAPKLHSEPSKKGETPTVDGT
WKTPSFPKKKTAASSNGSGQPLDKKAAVSWLTPAPSKKADSVAAKVDLLGEFQSALPKINSHPTRSQKKS
SQKKSSKKNHPQKNAPQNSTQAHSENKCSGASQKLPRKMVAIDCEMVGTGPKGHVSSLARCSIVNYNGDV
LYDEYILPPCHIVDYRTRWSGIRKQHMVNATPFKIARGQILKILTGKIVVGHAIHNDFKALQYFHPKSLT
RDTSHIPPLNRKADCPENATMSLKHLTKKLLNRDIQVGKSGHSSVEDAQATMELYKLVEVEWEEHLARNP
PTD

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_112242
RefSeq Size 2051
RefSeq ORF 1059
Synonyms FLJ12671
Locus ID 81875
UniProt ID Q9H9L3
Cytogenetics 1q23.1
Summary This gene encodes a 3'-5' exoribonuclease that may be involved in the processing of the 12S pre-rRNA. Pseudogenes have been identified on chromosomes 6 and 11. [provided by RefSeq, Dec 2014]
Write Your Own Review
You're reviewing:ISG20L2 (NM_030980) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC403104 ISG20L2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY403104 Transient overexpression lysate of interferon stimulated exonuclease gene 20kDa-like 2 (ISG20L2) 100 ug
$436.00
TP300946 Recombinant protein of human interferon stimulated exonuclease gene 20kDa-like 2 (ISG20L2), 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.