OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

ISG20L2 (NM_030980) Human Mass Spec Standard

Be the first to review this product
SKU
PH300946
ISG20L2 MS Standard C13 and N15-labeled recombinant protein (NP_112242)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA331705 Rabbit Polyclonal Anti-ISG20L2 Antibody
100 ul
$585.00
LY403104 Transient overexpression lysate of interferon stimulated exonuclease gene 20kDa-like 2 (ISG20L2) (as WB positive control) 100 ug
$436.00

Other products for "ISG20L2 or NM_030980"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC200946
Predicted MW 39.2 kDa
Protein Sequence
Protein Sequence
>RC200946 protein sequence
Red=Cloning site Green=Tags(s)

MSTLLLNLDFGEPPPKKALEGNAKHRNFVKKRRLLERRGFLSKKNQPPSKAPKLHSEPSKKGETPTVDGT
WKTPSFPKKKTAASSNGSGQPLDKKAAVSWLTPAPSKKADSVAAKVDLLGEFQSALPKINSHPTRSQKKS
SQKKSSKKNHPQKNAPQNSTQAHSENKCSGASQKLPRKMVAIDCEMVGTGPKGHVSSLARCSIVNYNGDV
LYDEYILPPCHIVDYRTRWSGIRKQHMVNATPFKIARGQILKILTGKIVVGHAIHNDFKALQYFHPKSLT
RDTSHIPPLNRKADCPENATMSLKHLTKKLLNRDIQVGKSGHSSVEDAQATMELYKLVEVEWEEHLARNP
PTD

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_112242
RefSeq Size 2051
RefSeq ORF 1059
Synonyms FLJ12671
Locus ID 81875
UniProt ID Q9H9L3
Cytogenetics 1q23.1
Summary This gene encodes a 3'-5' exoribonuclease that may be involved in the processing of the 12S pre-rRNA. Pseudogenes have been identified on chromosomes 6 and 11. provided by RefSeq, Dec 2014
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "ISG20L2" proteins (3)
SKU Description Size Price
LC403104 Lyophilized ISG20L2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY403104 Transient overexpression lysate of interferon stimulated exonuclease gene 20kDa-like 2 (ISG20L2) (as WB positive control) 100 ug
$436.00
TP300946 Recombinant protein of human interferon stimulated exonuclease gene 20kDa-like 2 (ISG20L2), 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products