ISG20L2 Rabbit Polyclonal Antibody

SKU TA331705

Rabbit Polyclonal Anti-ISG20L2 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-ISG20L2 Antibody is: synthetic peptide directed towards the N-terminal region of Human ISG20L2. Synthetic peptide located within the following region: KVDLLGEFQSALPKINSHPTRSQKKSSQKKSSKKNHPQKNAPQNSTQAHS
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 39 kDa
• Gene Name: interferon stimulated exonuclease gene 20kDa like 2
• Database Link:
  NP_112242
  Q9H9L3
• Background: ISG20L2 is a 3'-> 5'-exoribonuclease involved in ribosome biogenesis in the processing of the 12S pre-rRNA. It displays a strong specificity for a 3'-end containing a free hydroxyl group.
• Synonyms: FLJ12671
• Note: Immunogen sequence homology: Human: 100%

Reference Data