DARPP32 (PPP1R1B) (NM_181505) Human Mass Spec Standard

SKU PH300916

PPP1R1B MS Standard C13 and N15-labeled recombinant protein (NP_852606)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC200916]
• Predicted MW: 18.7 kDa
• Protein Sequence:
  Protein Sequence

  >RC200916 protein sequence; Red=Cloning site Green=Tags(s); ; MLFRLSEHSSPEEEASPHQRASGEGHHLKSKRPNPCAYTPPSLKAVQRIAESHLQSISNLNENQASEEED; ELGELRELGYPREEDEEEEEDDEEEEEEEDSQAEVLKVIRQSAGQKTTCGQGLEGPWERPPPLDESERDG; GSEDQVEDPALSEPGEEPQRPSPSEPGT; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_852606
• RefSeq Size: 1530
• RefSeq ORF: 504
• Synonyms: DARPP-32; DARPP32
• Locus ID: 84152
• UniProt ID: Q9UD71
• Cytogenetics: 17q12
• Summary: This gene encodes a bifunctional signal transduction molecule. Dopaminergic and glutamatergic receptor stimulation regulates its phosphorylation and function as a kinase or phosphatase inhibitor. As a target for dopamine, this gene may serve as a therapeutic target for neurologic and psychiatric disorders. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2011]
• Protein Families: Druggable Genome