SSU72 (NM_014188) Human Mass Spec Standard

SKU
PH300900
SSU72 MS Standard C13 and N15-labeled recombinant protein (NP_054907)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC200900]
Predicted MW 22.6 kDa
Protein Sequence
Protein Sequence
>RC200900 protein sequence
Red=Cloning site Green=Tags(s)

MPSSPLRVAVVCSSNQNRSMEAHNILSKRGFSVRSFGTGTHVKLPGPAPDKPNVYDFKTTYDQMYNDLLR
KDKELYTQNGILHMLDRNKRIKPRPERFQNCKDLFDLILTCEERVYDQVVEDLNSREQETCQPVHVVNVD
IQDNHEEATLGAFLICELCQCIQHTEDMENEIDELLQEFEEKSGRTFLHTVCFY

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_054907
RefSeq Size 1319
RefSeq ORF 582
Synonyms HSPC182; PNAS-120
Locus ID 29101
UniProt ID Q9NP77
Cytogenetics 1p36.33
Summary Protein phosphatase that catalyzes the dephosphorylation of the C-terminal domain of RNA polymerase II. Plays a role in RNA processing and termination. Plays a role in pre-mRNA polyadenylation via its interaction with SYMPK.[UniProtKB/Swiss-Prot Function]
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:SSU72 (NM_014188) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC415450 SSU72 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY415450 Transient overexpression lysate of SSU72 RNA polymerase II CTD phosphatase homolog (S. cerevisiae) (SSU72) 100 ug
$436.00
TP300900 Recombinant protein of human SSU72 RNA polymerase II CTD phosphatase homolog (S. cerevisiae) (SSU72), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.