SSU72 (NM_014188) Human Tagged ORF Clone

SKU
RC200900
SSU72 (Myc-DDK-tagged)-Human SSU72 RNA polymerase II CTD phosphatase homolog (S. cerevisiae) (SSU72)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol SSU72
Synonyms HSPC182; PNAS-120
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC200900 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCGTCGTCCCCGCTGCGGGTGGCGGTGGTGTGCTCGAGCAACCAGAACCGGAGCATGGAGGCGCACA
ACATCCTCAGCAAACGGGGATTCAGCGTCCGATCCTTTGGAACAGGGACTCACGTGAAGCTTCCAGGACC
AGCTCCCGACAAGCCCAATGTTTATGATTTCAAAACCACATATGACCAGATGTACAATGATCTTCTTAGG
AAAGACAAAGAACTCTATACACAGAATGGGATTTTACATATGCTGGACAGAAATAAGAGAATCAAGCCCC
GGCCAGAAAGATTCCAGAACTGCAAAGACCTGTTTGATCTGATCCTCACTTGCGAAGAGAGAGTGTATGA
CCAGGTGGTGGAAGATCTGAATTCCAGAGAACAGGAGACCTGCCAGCCCGTGCACGTGGTCAATGTGGAC
ATCCAGGACAACCACGAGGAGGCCACCCTGGGGGCGTTTCTCATCTGTGAGCTCTGCCAGTGTATCCAGC
ACACGGAAGACATGGAGAACGAGATCGACGAGCTGCTGCAGGAGTTCGAGGAGAAGAGTGGCCGCACCTT
TCTGCACACCGTCTGCTTCTAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC200900 protein sequence
Red=Cloning site Green=Tags(s)

MPSSPLRVAVVCSSNQNRSMEAHNILSKRGFSVRSFGTGTHVKLPGPAPDKPNVYDFKTTYDQMYNDLLR
KDKELYTQNGILHMLDRNKRIKPRPERFQNCKDLFDLILTCEERVYDQVVEDLNSREQETCQPVHVVNVD
IQDNHEEATLGAFLICELCQCIQHTEDMENEIDELLQEFEEKSGRTFLHTVCFY

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_014188
ORF Size 582 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_014188.1
RefSeq Size 1319 bp
RefSeq ORF 585 bp
Locus ID 29101
UniProt ID Q9NP77
Cytogenetics 1p36.33
Domains Ssu72
Protein Families Druggable Genome
MW 22.6 kDa
Summary Protein phosphatase that catalyzes the dephosphorylation of the C-terminal domain of RNA polymerase II. Plays a role in RNA processing and termination. Plays a role in pre-mRNA polyadenylation via its interaction with SYMPK.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:SSU72 (NM_014188) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC200900L1 Lenti ORF clone of Human SSU72 RNA polymerase II CTD phosphatase homolog (S. cerevisiae) (SSU72), Myc-DDK-tagged 10 ug
$600.00
RC200900L2 Lenti ORF clone of Human SSU72 RNA polymerase II CTD phosphatase homolog (S. cerevisiae) (SSU72), mGFP tagged 10 ug
$600.00
RC200900L3 Lenti ORF clone of Human SSU72 RNA polymerase II CTD phosphatase homolog (S. cerevisiae) (SSU72), Myc-DDK-tagged 10 ug
$600.00
RC200900L4 Lenti ORF clone of Human SSU72 RNA polymerase II CTD phosphatase homolog (S. cerevisiae) (SSU72), mGFP tagged 10 ug
$600.00
RG200900 SSU72 (tGFP-tagged) - Human SSU72 RNA polymerase II CTD phosphatase homolog (S. cerevisiae) (SSU72) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC115128 SSU72 (untagged)-Human SSU72 RNA polymerase II CTD phosphatase homolog (S. cerevisiae) (SSU72) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.