OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

HSCB (NM_172002) Human Mass Spec Standard

Be the first to review this product
SKU
PH300843
HSCB MS Standard C13 and N15-labeled recombinant protein (NP_741999)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA507274 HSCB mouse monoclonal antibody, clone OTI3E1 (formerly 3E1) 100 ul
$447.00
LY406803 Transient overexpression lysate of HscB iron-sulfur cluster co-chaperone homolog (E. coli) (HSCB) (as WB positive control) 100 ug
$436.00

Other products for "HSCB or NM_172002"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC200843
Predicted MW 27.2 kDa
Protein Sequence
Protein Sequence
>RC200843 representing NM_172002
Red=Cloning site Green=Tags(s)

MWRGRAGALLRVWGFWPTGVPRRRPLSCDAASQAGSNYPRCWNCGGPWGPGREDRFFCPQCRALQAPDPT
RDYFSLMDCNRSFRVDTAKLQHRYQQLQRLVHPDFFSQRSQTEKDFSEKHSTLVNDAYKTLLAPLSRGLY
LLKLHGIEIPERTDYEMDRQFLIEIMEINEKLAEAESEAAMKEIESIVKAKQKEFTDNVSSAFEQDDFEE
AKEILTKMRYFSNIEEKIKLKKIPL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_741999
RefSeq Size 1106
RefSeq ORF 705
Synonyms DNAJC20; HSC20; JAC1
Locus ID 150274
UniProt ID Q8IWL3
Cytogenetics 22q12.1
Summary This gene encodes a DnaJ-type co-chaperone and member of the heat shock cognate B (HscB) family of proteins. The encoded protein plays a role in the synthesis of iron-sulfur clusters, protein cofactors that are involved in the redox reactions of mitochondrial electron transport and other processes. Cells in which this gene is knocked down exhibit reduced activity of iron-sulfur cluster-dependent enzymes including succinate dehydrogenase and aconitase. The encoded protein may stimulate the ATPase activity of the mitochondrial stress-70 protein. Alternative splicing results in multiple transcript variants. provided by RefSeq, Dec 2015
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "HSCB" proteins (3)
SKU Description Size Price
LC406803 Lyophilized HSCB HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY406803 Transient overexpression lysate of HscB iron-sulfur cluster co-chaperone homolog (E. coli) (HSCB) (as WB positive control) 100 ug
$436.00
TP300843 Recombinant protein of human HscB iron-sulfur cluster co-chaperone homolog (E. coli) (HSCB), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products