OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

SLC35A4 (NM_080670) Human Mass Spec Standard

Be the first to review this product
SKU
PH300808
SLC35A4 MS Standard C13 and N15-labeled recombinant protein (NP_542401)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA333556 Rabbit Polyclonal Anti-SLC35A4 Antibody
100 ul
$585.00
LY409055 Transient overexpression lysate of solute carrier family 35, member A4 (SLC35A4) (as WB positive control) 100 ug
$436.00

Other products for "SLC35A4 or NM_080670"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC200808
Predicted MW 34.6 kDa
Protein Sequence
Protein Sequence
>RC200808 protein sequence
Red=Cloning site Green=Tags(s)

MSVEDGGMPGLGRPRQARWTLMLLLSTAMYGAHAPLLALCHVDGRVPFRPSSAVLLTELTKLLLCAFSLL
VGWQAWPQGPPPWRQAAPFALSALLYGANNNLVIYLQRYMDPSTYQVLSNLKIGSTAVLYCLCLRHRLSV
RQGLALLLLMAAGACYAAGGLQVPGNTLPSPPPAAAASPMPLHITPLGLLLLILYCLISGLSSVYTELLM
KRQRLPLALQNLFLYTFGVLLNLGLHAGGGSGPGLLEGFSGWAALVVLSQALNGLLMSAVMKHGSSITRL
FVVSCSLVVNAVLSAVLLRLQLTAAFFLATLLIGLAMRLYYGSR

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_542401
RefSeq Size 2676
RefSeq ORF 972
Locus ID 113829
UniProt ID Q96G79
Cytogenetics 5q31.3
Protein Families Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "SLC35A4" proteins (3)
SKU Description Size Price
LC409055 Lyophilized SLC35A4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY409055 Transient overexpression lysate of solute carrier family 35, member A4 (SLC35A4) (as WB positive control) 100 ug
$436.00
TP300808 Recombinant protein of human solute carrier family 35, member A4 (SLC35A4), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products