MANBAL (NM_001003897) Human Mass Spec Standard

SKU
PH300796
MANBAL MS Standard C13 and N15-labeled recombinant protein (NP_001003897)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC200796]
Predicted MW 9.5 kDa
Protein Sequence
Protein Sequence
>RC200796 protein sequence
Red=Cloning site Green=Tags(s)

MASDLDFSPPEVPEPTFLENLLRYGLFLGAIFQLICVLAIIVPIPKSHEAEAEPSEPRSAEVTRKPKAAV
PSVNKRPKKETKKKR

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001003897
RefSeq Size 1268
RefSeq ORF 255
Locus ID 63905
UniProt ID Q9NQG1
Cytogenetics 20q11.23
Protein Families Transmembrane
Write Your Own Review
You're reviewing:MANBAL (NM_001003897) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH305099 MANBAL MS Standard C13 and N15-labeled recombinant protein (NP_071360) 10 ug
$3,255.00
LC411800 MANBAL HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC424033 MANBAL HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY411800 Transient overexpression lysate of mannosidase, beta A, lysosomal-like (MANBAL), transcript variant 1 100 ug
$436.00
LY424033 Transient overexpression lysate of mannosidase, beta A, lysosomal-like (MANBAL), transcript variant 2 100 ug
$436.00
TP300796 Recombinant protein of human mannosidase, beta A, lysosomal-like (MANBAL), transcript variant 2, 20 µg 20 ug
$867.00
TP305099 Recombinant protein of human mannosidase, beta A, lysosomal-like (MANBAL), transcript variant 1, 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.