OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

MIS12 (NM_024039) Human Mass Spec Standard

Be the first to review this product
SKU
PH300789
MIS12 MS Standard C13 and N15-labeled recombinant protein (NP_076944)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA344385 Rabbit Polyclonal Anti-MIS12 Antibody - middle region
100 ul
$585.00
LY411415 Transient overexpression lysate of MIS12, MIND kinetochore complex component, homolog (S. pombe) (MIS12) (as WB positive control) 100 ug
$436.00

Other products for "MIS12 or NM_024039"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC200789
Predicted MW 24.1 kDa
Protein Sequence
Protein Sequence
>RC200789 protein sequence
Red=Cloning site Green=Tags(s)

MSVDPMTYEAQFFGFTPQTCMLRIYIAFQDYLFEVMQAVEQVILKKLDGIPDCDISPVQIRKCTEKFLCF
MKGHFDNLFSKMEQLFLQLILRIPSNILLPEDKCKETPYSEEDFQHLQKEIEQLQEKYKTELCTKQALLA
ELEEQKIVQAKLKQTLTFFDELHNVGRDHGTSDFRESLVSLVQNSRKLQNIRDNVEKESKRLKIS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_076944
RefSeq Size 2543
RefSeq ORF 615
Synonyms 2510025F08Rik; hMis12; KNTC2AP; MTW1
Locus ID 79003
UniProt ID Q9H081
Cytogenetics 17p13.2
Summary Part of the MIS12 complex which is required for normal chromosome alignment and segregation and for kinetochore formation during mitosis (PubMed:12515822, PubMed:15502821, PubMed:16585270). Essential for proper kinetochore microtubule attachments (PubMed:23891108).UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "MIS12" proteins (3)
SKU Description Size Price
LC411415 Lyophilized MIS12 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY411415 Transient overexpression lysate of MIS12, MIND kinetochore complex component, homolog (S. pombe) (MIS12) (as WB positive control) 100 ug
$436.00
TP300789 Recombinant protein of human MIS12, MIND kinetochore complex component, homolog (yeast) (MIS12), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products