MIS12 (NM_024039) Human Mass Spec Standard

SKU
PH300789
MIS12 MS Standard C13 and N15-labeled recombinant protein (NP_076944)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC200789]
Predicted MW 24.1 kDa
Protein Sequence
Protein Sequence
>RC200789 protein sequence
Red=Cloning site Green=Tags(s)

MSVDPMTYEAQFFGFTPQTCMLRIYIAFQDYLFEVMQAVEQVILKKLDGIPDCDISPVQIRKCTEKFLCF
MKGHFDNLFSKMEQLFLQLILRIPSNILLPEDKCKETPYSEEDFQHLQKEIEQLQEKYKTELCTKQALLA
ELEEQKIVQAKLKQTLTFFDELHNVGRDHGTSDFRESLVSLVQNSRKLQNIRDNVEKESKRLKIS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_076944
RefSeq Size 2543
RefSeq ORF 615
Synonyms 2510025F08Rik; hMis12; KNTC2AP; MTW1
Locus ID 79003
UniProt ID Q9H081
Cytogenetics 17p13.2
Summary Part of the MIS12 complex which is required for normal chromosome alignment and segregation and for kinetochore formation during mitosis (PubMed:12515822, PubMed:15502821, PubMed:16585270). Essential for proper kinetochore microtubule attachments (PubMed:23891108).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:MIS12 (NM_024039) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC411415 MIS12 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY411415 Transient overexpression lysate of MIS12, MIND kinetochore complex component, homolog (S. pombe) (MIS12) 100 ug
$436.00
TP300789 Recombinant protein of human MIS12, MIND kinetochore complex component, homolog (yeast) (MIS12), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.