MIS12 (NM_024039) Human Tagged ORF Clone

SKU
RC200789
MIS12 (Myc-DDK-tagged)-Human MIS12, MIND kinetochore complex component, homolog (S. pombe) (MIS12)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol MIS12
Synonyms 2510025F08Rik; hMis12; KNTC2AP; MTW1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC200789 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCTGTGGATCCAATGACCTACGAGGCCCAGTTCTTTGGCTTCACGCCACAAACGTGCATGCTTCGGA
TCTACATTGCATTTCAAGACTACCTATTTGAAGTGATGCAGGCCGTTGAACAGGTTATTCTGAAGAAGCT
GGATGGCATCCCAGACTGTGACATTAGCCCAGTGCAGATTCGCAAATGCACAGAGAAGTTTCTTTGCTTC
ATGAAAGGACATTTTGATAACCTTTTTAGCAAAATGGAGCAACTGTTTTTGCAGCTGATTTTACGTATTC
CCTCAAACATCTTGCTTCCTGAAGATAAATGTAAGGAGACACCTTATAGTGAGGAAGATTTTCAGCATCT
CCAGAAAGAAATTGAACAGTTACAGGAGAAGTACAAGACTGAATTATGTACTAAGCAGGCCCTTCTTGCA
GAATTAGAAGAGCAAAAAATTGTTCAGGCCAAACTCAAACAGACGTTGACTTTCTTTGATGAGCTTCATA
ATGTTGGCAGAGATCATGGGACTAGTGATTTTAGGGAGAGTTTAGTATCCCTGGTTCAGAACTCCAGAAA
ACTACAGAACATTAGAGACAATGTGGAAAAGGAATCGAAACGACTGAAAATATCT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC200789 protein sequence
Red=Cloning site Green=Tags(s)

MSVDPMTYEAQFFGFTPQTCMLRIYIAFQDYLFEVMQAVEQVILKKLDGIPDCDISPVQIRKCTEKFLCF
MKGHFDNLFSKMEQLFLQLILRIPSNILLPEDKCKETPYSEEDFQHLQKEIEQLQEKYKTELCTKQALLA
ELEEQKIVQAKLKQTLTFFDELHNVGRDHGTSDFRESLVSLVQNSRKLQNIRDNVEKESKRLKIS

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_024039
ORF Size 615 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_024039.2
RefSeq Size 2543 bp
RefSeq ORF 618 bp
Locus ID 79003
UniProt ID Q9H081
Cytogenetics 17p13.2
MW 24.1 kDa
Summary Part of the MIS12 complex which is required for normal chromosome alignment and segregation and for kinetochore formation during mitosis (PubMed:12515822, PubMed:15502821, PubMed:16585270). Essential for proper kinetochore microtubule attachments (PubMed:23891108).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:MIS12 (NM_024039) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC200789L1 Lenti ORF clone of Human MIS12, MIND kinetochore complex component, homolog (S. pombe) (MIS12), Myc-DDK-tagged 10 ug
$600.00
RC200789L2 Lenti ORF clone of Human MIS12, MIND kinetochore complex component, homolog (S. pombe) (MIS12), mGFP tagged 10 ug
$600.00
RC200789L3 Lenti ORF clone of Human MIS12, MIND kinetochore complex component, homolog (S. pombe) (MIS12), Myc-DDK-tagged 10 ug
$600.00
RC200789L4 Lenti ORF clone of Human MIS12, MIND kinetochore complex component, homolog (S. pombe) (MIS12), mGFP tagged 10 ug
$600.00
RG200789 MIS12 (tGFP-tagged) - Human MIS12, MIND kinetochore complex component, homolog (S. pombe) (MIS12) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC321350 MIS12 (untagged)-Human MIS12, MIND kinetochore complex component, homolog (S. pombe) (MIS12) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.