TMED9 (NM_017510) Human Mass Spec Standard

SKU
PH300652
TMED9 MS Standard C13 and N15-labeled recombinant protein (NP_059980)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC200652]
Predicted MW 27.3 kDa
Protein Sequence
Protein Sequence
>Peptide sequence encoded by RC200652
Blue=ORF Red=Cloning site Green=Tag(s)

MAVELGVLLVRPRPGTGLGRVMRTLLLVLWLATRGSALYFHIGETEKKCFIEEIPDETMVIGNYRTQLY
DKQREEYQPATPGLGMFVEVKDPEDKVILARQYGSEGRFTFTSHTPGEHQICLHSNSTKFSLFAGGMLR
VHLDIQVGEHANDYAEIAAKDKLSELQLRVRQLVEQVEQIQKEQNYQRWREERFRQTSESTNQRVLWWS
ILQTLILVAIGVWQMRHLKSFFEAKKLV

myc-FLAG tag

Recombinant protein using RC200652 also available, TP300652
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_059980
RefSeq Size 1402
RefSeq ORF 705
Synonyms GMP25; HSGP25L2G; p24a2; p24alpha2; p25
Locus ID 54732
UniProt ID Q9BVK6
Cytogenetics 5q35.3
Summary This gene is a member of a family of genes encoding transport proteins located in the endoplasmic reticulum and the Golgi. A similar gene in mouse is the target of microRNA miR-296, which is part of an imprinted cluster. [provided by RefSeq, Jul 2016]
Protein Families Transmembrane
Write Your Own Review
You're reviewing:TMED9 (NM_017510) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC402594 TMED9 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY402594 Transient overexpression lysate of transmembrane emp24 protein transport domain containing 9 (TMED9) 100 ug
$436.00
TP300652 Recombinant protein of human transmembrane emp24 protein transport domain containing 9 (TMED9), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.