TMED9 (NM_017510) Human Tagged ORF Clone

SKU
RC200652
TMED9 (Myc-DDK-tagged)-Human transmembrane emp24 protein transport domain containing 9 (TMED9)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol TMED9
Synonyms GMP25; HSGP25L2G; p24a2; p24alpha2; p25
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC200652 representing NM_017510.
Blue=ORF Red=Cloning site Green=Tag(s)

GCTCGTTTAGTGAACCGTCAGAATTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTG
GATCCGGTACCGAGGAGATCTGCCGCCGCGATCGCC
ATGGCTGTGGAGCTGGGCGTGCTGCTCGTCCGGCCCCGGCCCGGAACCGGGCTGGGTAGAGTGATGCGG
ACCCTCCTGCTGGTGCTGTGGCTGGCGACGCGCGGAAGCGCGCTCTACTTTCACATCGGAGAGACGGAG
AAGAAGTGCTTTATTGAGGAGATCCCGGACGAGACCATGGTCATAGGAAACTACCGGACGCAGCTGTAT
GACAAGCAGCGGGAGGAGTACCAGCCGGCCACCCCGGGGCTTGGCATGTTTGTGGAGGTGAAGGACCCA
GAGGACAAGGTCATCCTGGCCCGGCAGTATGGCTCCGAGGGCAGGTTCACTTTCACTTCCCATACCCCT
GGTGAGCACCAGATCTGTCTTCACTCCAATTCCACCAAGTTCTCCCTCTTTGCTGGAGGCATGCTGAGA
GTTCACCTGGACATCCAGGTAGGTGAACATGCCAATGACTATGCGGAAATTGCTGCTAAAGACAAGTTG
AGTGAGTTGCAGCTACGAGTGCGACAGCTGGTGGAACAAGTGGAGCAGATCCAGAAAGAGCAGAACTAC
CAGCGGTGGCGAGAGGAGCGCTTCCGGCAGACCAGTGAGAGCACCAACCAGCGGGTGCTGTGGTGGTCC
ATTCTGCAGACCCTCATCCTCGTGGCCATCGGTGTCTGGCAGATGCGGCACCTCAAGAGCTTCTTTGAA
GCCAAGAAGCTTGTG

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGAT
TACAAGGATGACGACGATAAG
GTTTAAACGGCCGGC
Protein Sequence
>Peptide sequence encoded by RC200652
Blue=ORF Red=Cloning site Green=Tag(s)

MAVELGVLLVRPRPGTGLGRVMRTLLLVLWLATRGSALYFHIGETEKKCFIEEIPDETMVIGNYRTQLY
DKQREEYQPATPGLGMFVEVKDPEDKVILARQYGSEGRFTFTSHTPGEHQICLHSNSTKFSLFAGGMLR
VHLDIQVGEHANDYAEIAAKDKLSELQLRVRQLVEQVEQIQKEQNYQRWREERFRQTSESTNQRVLWWS
ILQTLILVAIGVWQMRHLKSFFEAKKLV

myc-FLAG tag

Recombinant protein using RC200652 also available, TP300652
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_017510
ORF Size 705 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq Size 1402 bp
RefSeq ORF 708 bp
Locus ID 54732
UniProt ID Q9BVK6
Cytogenetics 5q35.3
Domains EMP24_GP25L
Protein Families Transmembrane
MW 27.3 kDa
Summary This gene is a member of a family of genes encoding transport proteins located in the endoplasmic reticulum and the Golgi. A similar gene in mouse is the target of microRNA miR-296, which is part of an imprinted cluster. [provided by RefSeq, Jul 2016]
Write Your Own Review
You're reviewing:TMED9 (NM_017510) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC200652L1 Lenti ORF clone of Human transmembrane emp24 protein transport domain containing 9 (TMED9), Myc-DDK-tagged 10 ug
$600.00
RC200652L2 Lenti ORF clone of Human transmembrane emp24 protein transport domain containing 9 (TMED9), mGFP tagged 10 ug
$600.00
RC200652L3 Lenti ORF clone of Human transmembrane emp24 protein transport domain containing 9 (TMED9), Myc-DDK-tagged 10 ug
$600.00
RC200652L4 Lenti ORF clone of Human transmembrane emp24 protein transport domain containing 9 (TMED9), mGFP tagged 10 ug
$600.00
RG200652 TMED9 (tGFP-tagged) - Human transmembrane emp24 protein transport domain containing 9 (TMED9) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC319051 TMED9 (untagged)-Human transmembrane emp24 protein transport domain containing 9 (TMED9) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.