OriGene Logo

ESE1 (ELF3) (NM_004433) Human Mass Spec Standard

Be the first to review this product
SKU
PH300631
ELF3 MS Standard C13 and N15-labeled recombinant protein (NP_004424)
Size:
10 ug
In Control Promo
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA809989 ELF3 mouse monoclonal antibody,clone OTI6G6
100 ul
$447.00
LY401407 Transient overexpression lysate of E74-like factor 3 (ets domain transcription factor, epithelial-specific ) (ELF3), transcript variant 1 100 ug
$436.00

Other products for "ESE1 or NM_004433"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC200631
Predicted MW 41.5 kDa
Protein Sequence
Protein Sequence
>RC200631 protein sequence
Red=Cloning site Green=Tags(s)

MAATCEISNIFSNYFSAMYSSEDSTLASVPPAATFGADDLVLTLSNPQMSLEGTEKASWLGEQPQFWSKT
QVLDWISYQVEKNKYDASAIDFSRCDMDGATLCNCALEELRLVFGPLGDQLHAQLRDLTSSSSDELSWII
ELLEKDGMAFQEALDPGPFDQGSPFAQELLDDGQQASPYHPGSCGAGAPSPGSSDVSTAGTGASRSSHSS
DSGGSDVDLDPTDGKLFPSDGFRDCKKGDPKHGKRKRGRPRKLSKEYWDCLEGKKSKHAPRGTHLWEFIR
DILIHPELNEGLMKWENRHEGVFKFLRSEAVAQLWGQKKKNSNMTYEKLSRAMRYYYKREILERVDGRRL
VYKFGKNSSGWKEEEVLQSRN

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_004424
RefSeq Size 3149
RefSeq ORF 1113
Synonyms EPR-1; ERT; ESE-1; ESX
Locus ID 1999
UniProt ID P78545
Cytogenetics 1q32.1
Summary Transcriptional activator that binds and transactivates ETS sequences containing the consensus nucleotide core sequence GGAAT. Acts synergistically with POU2F3 to transactivate the SPRR2A promoter and with RUNX1 to transactivate the ANGPT1 promoter. Also transactivates collagenase, CCL20, CLND7, FLG, KRT8, NOS2, PTGS2, SPRR2B, TGFBR2 and TGM3 promoters. Represses KRT4 promoter activity. Involved in mediating vascular inflammation. May play an important role in epithelial cell differentiation and tumorigenesis. May be a critical downstream effector of the ERBB2 signaling pathway. May be associated with mammary gland development and involution. Plays an important role in the regulation of transcription with TATA-less promoters in preimplantation embryos, which is essential in preimplantation development (By similarity).UniProtKB/Swiss-Prot Function
Protein Families Transcription Factors
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources
Other "ESE1" proteins (5)
SKU Description Size Price
LC401407 ELF3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC426477 ELF3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY401407 Transient overexpression lysate of E74-like factor 3 (ets domain transcription factor, epithelial-specific ) (ELF3), transcript variant 1 100 ug
$436.00
LY426477 Transient overexpression lysate of E74-like factor 3 (ets domain transcription factor, epithelial-specific ) (ELF3), transcript variant 2 100 ug
$436.00
TP300631 Recombinant protein of human E74-like factor 3 (ets domain transcription factor, epithelial-specific ) (ELF3), transcript variant 1, 20 µg 20 ug
$737.00
OriGene AI

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.