Pirin (PIR) (NM_001018109) Human Mass Spec Standard

SKU
PH300626
PIR MS Standard C13 and N15-labeled recombinant protein (NP_001018119)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC200626]
Predicted MW 32.1 kDa
Protein Sequence
Protein Sequence
>RC200626 protein sequence
Red=Cloning site Green=Tags(s)

MGSSKKVTLSVLSREQSEGVGARVRRSIGRPELKNLDPFLLFDEFKGGRPGGFPDHPHRGFETVSYLLEG
GSMAHEDFCGHTGKMNPGDLQWMTAGRGILHAEMPCSEEPAHGLQLWVNLRSSEKMVEPQYQELKSEEIP
KPSKDGVTVAVISGEALGIKSKVYTRTPTLYLDFKLDPGAKHSQPIPKGWTSFIYTISGDVYIGPDDAQQ
KIEPHHTAVLGEGDSVQVENKDPKRSHFVLIAGEPLREPVIQHGPFVMNTNEEISQAILDFRNAKNGFER
AKTWKSKIGN

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001018119
RefSeq Size 1542
RefSeq ORF 870
Locus ID 8544
UniProt ID O00625
Cytogenetics Xp22.2
Summary This gene encodes a member of the cupin superfamily. The encoded protein is an Fe(II)-containing nuclear protein expressed in all tissues of the body and concentrated within dot-like subnuclear structures. Interactions with nuclear factor I/CCAAT box transcription factor as well as B cell lymphoma 3-encoded oncoprotein suggest the encoded protein may act as a transcriptional cofactor and be involved in the regulation of DNA transcription and replication. Alternatively spliced transcript variants have been described. [provided by RefSeq, Jul 2008]
Protein Families Transcription Factors
Write Your Own Review
You're reviewing:Pirin (PIR) (NM_001018109) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH323111 PIR MS Standard C13 and N15-labeled recombinant protein (NP_003653) 10 ug
$3,255.00
LC401212 PIR HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC422656 PIR HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY401212 Transient overexpression lysate of pirin (iron-binding nuclear protein) (PIR), transcript variant 1 100 ug
$436.00
LY422656 Transient overexpression lysate of pirin (iron-binding nuclear protein) (PIR), transcript variant 2 100 ug
$436.00
TP300626 Recombinant protein of human pirin (iron-binding nuclear protein) (PIR), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP323111 Recombinant protein of human pirin (iron-binding nuclear protein) (PIR), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.