Pirin (PIR) (NM_001018109) Human Tagged ORF Clone

SKU
RC200626
PIR (Myc-DDK-tagged)-Human pirin (iron-binding nuclear protein) (PIR), transcript variant 2
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol Pirin
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC200626 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGGTCCTCCAAGAAAGTTACTCTCTCAGTGCTCAGCCGGGAGCAGTCGGAAGGGGTTGGAGCGAGGG
TCCGGAGAAGCATTGGCAGACCCGAGTTAAAAAATCTGGATCCGTTTTTACTGTTTGATGAATTTAAAGG
AGGTAGACCAGGAGGATTTCCTGATCATCCACATCGAGGTTTTGAAACAGTATCCTACCTCCTGGAAGGG
GGCAGCATGGCCCATGAAGACTTCTGTGGACACACTGGTAAAATGAACCCAGGAGATTTGCAGTGGATGA
CTGCGGGCCGGGGCATTCTGCACGCTGAGATGCCTTGCTCAGAGGAGCCAGCCCATGGCCTACAACTGTG
GGTTAATTTGAGGAGCTCAGAGAAGATGGTGGAGCCTCAGTACCAGGAACTGAAAAGTGAAGAAATCCCT
AAACCCAGTAAGGATGGTGTGACAGTTGCTGTCATTTCTGGAGAAGCCCTGGGAATAAAGTCCAAGGTTT
ACACTCGCACACCAACCTTATATTTGGACTTCAAATTGGACCCAGGAGCCAAACATTCCCAACCTATCCC
TAAAGGGTGGACAAGCTTCATTTACACGATATCTGGAGATGTGTATATTGGGCCCGATGATGCACAACAA
AAAATAGAACCTCATCACACAGCAGTGCTTGGAGAAGGTGACAGTGTCCAGGTGGAGAACAAGGATCCCA
AGAGAAGCCACTTTGTCTTAATTGCTGGGGAGCCATTAAGAGAACCAGTTATCCAACATGGTCCATTTGT
GATGAACACCAATGAAGAGATTTCTCAAGCTATTCTTGATTTCAGAAACGCAAAAAATGGGTTTGAAAGG
GCCAAAACCTGGAAATCAAAGATTGGGAAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC200626 protein sequence
Red=Cloning site Green=Tags(s)

MGSSKKVTLSVLSREQSEGVGARVRRSIGRPELKNLDPFLLFDEFKGGRPGGFPDHPHRGFETVSYLLEG
GSMAHEDFCGHTGKMNPGDLQWMTAGRGILHAEMPCSEEPAHGLQLWVNLRSSEKMVEPQYQELKSEEIP
KPSKDGVTVAVISGEALGIKSKVYTRTPTLYLDFKLDPGAKHSQPIPKGWTSFIYTISGDVYIGPDDAQQ
KIEPHHTAVLGEGDSVQVENKDPKRSHFVLIAGEPLREPVIQHGPFVMNTNEEISQAILDFRNAKNGFER
AKTWKSKIGN

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001018109
ORF Size 870 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001018109.3
RefSeq Size 1542 bp
RefSeq ORF 873 bp
Locus ID 8544
UniProt ID O00625
Cytogenetics Xp22.2
Protein Families Transcription Factors
MW 32.1 kDa
Summary This gene encodes a member of the cupin superfamily. The encoded protein is an Fe(II)-containing nuclear protein expressed in all tissues of the body and concentrated within dot-like subnuclear structures. Interactions with nuclear factor I/CCAAT box transcription factor as well as B cell lymphoma 3-encoded oncoprotein suggest the encoded protein may act as a transcriptional cofactor and be involved in the regulation of DNA transcription and replication. Alternatively spliced transcript variants have been described. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:Pirin (PIR) (NM_001018109) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC200626L1 Lenti ORF clone of Human pirin (iron-binding nuclear protein) (PIR), transcript variant 2, Myc-DDK-tagged 10 ug
$600.00
RC200626L2 Lenti ORF clone of Human pirin (iron-binding nuclear protein) (PIR), transcript variant 2, mGFP tagged 10 ug
$600.00
RC200626L3 Lenti ORF clone of Human pirin (iron-binding nuclear protein) (PIR), transcript variant 2, Myc-DDK-tagged 10 ug
$600.00
RC200626L4 Lenti ORF clone of Human pirin (iron-binding nuclear protein) (PIR), transcript variant 2, mGFP tagged 10 ug
$600.00
RG200626 PIR (tGFP-tagged) - Human pirin (iron-binding nuclear protein) (PIR), transcript variant 2 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC320195 PIR (untagged)-Human pirin (iron-binding nuclear protein) (PIR), transcript variant 2 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.