GDI2 (NM_001494) Human Mass Spec Standard

SKU
PH300596
GDI2 MS Standard C13 and N15-labeled recombinant protein (NP_001485)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC200596]
Predicted MW 50.7 kDa
Protein Sequence
Protein Sequence
>RC200596 protein sequence
Red=Cloning site Green=Tags(s)

MNEEYDVIVLGTGLTECILSGIMSVNGKKVLHMDRNPYYGGESASITPLEDLYKRFKIPGSPPESMGRGR
DWNVDLIPKFLMANGQLVKMLLYTEVTRYLDFKVTEGSFVYKGGKIYKVPSTEAEALASSLMGLFEKRRF
RKFLVYVANFDEKDPRTFEGIDPKKTTMRDVYKKFDLGQDVIDFTGHALALYRTDDYLDQPCYETINRIK
LYSESLARYGKSPYLYPLYGLGELPQGFARLSAIYGGTYMLNKPIEEIIVQNGKVIGVKSEGEIARCKQL
ICDPSYVKDRVEKVGQVIRVICILSHPIKNTNDANSCQIIIPQNQVNRKSDIYVCMISFAHNVAAQGKYI
AIVSTTVETKEPEKEIRPALELLEPIEQKFVSISDLLVPKDLGTESQIFISRTYDATTHFETTCDDIKNI
YKRMTGSEFDFEEMKRKKNDIYGED

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001485
RefSeq Size 2441
RefSeq ORF 1335
Synonyms HEL-S-46e; RABGDIB
Locus ID 2665
UniProt ID P50395
Cytogenetics 10p15.1
Summary GDP dissociation inhibitors are proteins that regulate the GDP-GTP exchange reaction of members of the rab family, small GTP-binding proteins of the ras superfamily, that are involved in vesicular trafficking of molecules between cellular organelles. GDIs slow the rate of dissociation of GDP from rab proteins and release GDP from membrane-bound rabs. GDI2 is ubiquitously expressed. The GDI2 gene contains many repetitive elements indicating that it may be prone to inversion/deletion rearrangements. Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:GDI2 (NM_001494) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC400572 GDI2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC426526 GDI2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY400572 Transient overexpression lysate of GDP dissociation inhibitor 2 (GDI2), transcript variant 1 100 ug
$436.00
LY426526 Transient overexpression lysate of GDP dissociation inhibitor 2 (GDI2), transcript variant 2 100 ug
$436.00
TP300596 Recombinant protein of human GDP dissociation inhibitor 2 (GDI2), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.