Actin Regulatory Protein CAPG (CAPG) (NM_001747) Human Mass Spec Standard

SKU
PH300497
CAPG MS Standard C13 and N15-labeled recombinant protein (NP_001738)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC200497]
Predicted MW 38.5 kDa
Protein Sequence
Protein Sequence
>RC200497 protein sequence
Red=Cloning site Green=Tags(s)

MYTAIPQSGSPFPGSVQDPGLHVWRVEKLKPVPVAQENQGVFFSGDSYLVLHNGPEEVSHLHLWIGQQSS
RDEQGACAVLAVHLNTLLGERPVQHREVQGNESDLFMSYFPRGLKYQEGGVESAFHKTSTGAPAAIKKLY
QVKGKKNIRATERALNWDSFNTGDCFILDLGQNIFAWCGGKSNILERNKARDLALAIRDSERQGKAQVEI
VTDGEEPAEMIQVLGPKPALKEGNPEEDLTADKANAQAAALYKVSDATGQMNLTKVADSSPFALELLISD
DCFVLDNGLCGKIYIWKGRKANEKERQAALQVAEGFISRMQYAPNTQVEILPQGRESPIFKQFFKDWK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001738
RefSeq Size 1604
RefSeq ORF 1044
Synonyms AFCP; HEL-S-66; MCP
Locus ID 822
UniProt ID P40121
Cytogenetics 2p11.2
Summary This gene encodes a member of the gelsolin/villin family of actin-regulatory proteins. The encoded protein reversibly blocks the barbed ends of F-actin filaments in a Ca2+ and phosphoinositide-regulated manner, but does not sever preformed actin filaments. By capping the barbed ends of actin filaments, the encoded protein contributes to the control of actin-based motility in non-muscle cells. Alternatively spliced transcript variants have been observed for this gene. [provided by RefSeq, Jan 2012]
Write Your Own Review
You're reviewing:Actin Regulatory Protein CAPG (CAPG) (NM_001747) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC419770 CAPG HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY419770 Transient overexpression lysate of capping protein (actin filament), gelsolin-like (CAPG) 100 ug
$436.00
TP300497 Recombinant protein of human capping protein (actin filament), gelsolin-like (CAPG), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.