LAMP2 (NM_013995) Human Mass Spec Standard

SKU
PH300456
LAMP2 MS Standard C13 and N15-labeled recombinant protein (NP_054701)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC200456]
Predicted MW 45 kDa
Protein Sequence
Protein Sequence
>RC200456 protein sequence
Red=Cloning site Green=Tags(s)

MVCFRLFPVPGSGLVLVCLVLGAVRSYALELNLTDSENATCLYAKWQMNFTVRYETTNKTYKTVTISDHG
TVTYNGSICGDDQNGPKIAVQFGPGFSWIANFTKAASTYSIDSVSFSYNTGDNTTFPDAEDKGILTVDEL
LAIRIPLNDLFRCNSLSTLEKNDVVQHYWDVLVQAFVQNGTVSTNEFLCDKDKTSTVAPTIHTTVPSPTT
TPTPKEKPEAGTYSVNNGNDTCLLATMGLQLNITQDKVASVININPNTTHSTGSCRSHTALLRLNSSTIK
YLDFVFAVKNENRFYLKEVNISMYLVNGSVFSIANNNLSYWDAPLGSSYMCNKEQTVSVSGAFQINTFDL
RVQPFNVTQGKYSTAQECSLDDDTILIPIIVGAGLSGLIIVIVIAYVIGRRKSYAGYQTL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_054701
RefSeq Size 4076
RefSeq ORF 1230
Synonyms CD107b; DND; LAMP-2; LAMPB; LGP-96; LGP110
Locus ID 3920
UniProt ID P13473
Cytogenetics Xq24
Summary The protein encoded by this gene is a member of a family of membrane glycoproteins. This glycoprotein provides selectins with carbohydrate ligands. It may play a role in tumor cell metastasis. It may also function in the protection, maintenance, and adhesion of the lysosome. Alternative splicing of this gene results in multiple transcript variants encoding distinct proteins. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome, ES Cell Differentiation/IPS, Transmembrane
Protein Pathways Lysosome
Write Your Own Review
You're reviewing:LAMP2 (NM_013995) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH321216 LAMP2 MS Standard C13 and N15-labeled recombinant protein (NP_002285) 10 ug
$3,255.00
PH325644 LAMP2 MS Standard C13 and N15-labeled recombinant protein (NP_001116078) 10 ug
$3,255.00
LC419414 LAMP2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY419414 Transient overexpression lysate of lysosomal-associated membrane protein 2 (LAMP2), transcript variant A 100 ug
$436.00
TP300456 Recombinant protein of human lysosomal-associated membrane protein 2 (LAMP2), transcript variant B, 20 µg 20 ug
$867.00
TP321216 Recombinant protein of human lysosomal-associated membrane protein 2 (LAMP2), transcript variant A, 20 µg 20 ug
$867.00
TP325644 Purified recombinant protein of Homo sapiens lysosomal-associated membrane protein 2 (LAMP2), transcript variant C, 20 µg 20 ug
$867.00
TP720402 Recombinant protein of human lysosomal-associated membrane protein 2 (LAMP2), transcript variant C 10 ug
$230.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.