OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PSMD8 (NM_002812) Human Mass Spec Standard

Be the first to review this product
SKU
PH300436
PSMD8 MS Standard C13 and N15-labeled recombinant protein (NP_002803)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA322953 Anti-PSMD8 Rabbit Polyclonal Antibody
100 ul
$305.00
LY419092 Transient overexpression lysate of proteasome (prosome, macropain) 26S subunit, non-ATPase, 8 (PSMD8) (as WB positive control) 100 ug
$436.00

Other products for "PSMD8 or NM_002812"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC200436
Predicted MW 30 kDa
Protein Sequence
Protein Sequence
>RC200436 protein sequence
Red=Cloning site Green=Tags(s)

MYEQLKGEWNRKSPNLSKCGEELGRLKLVLLELNFLPTTGTKLTKQQLILARDILEIGAQWSILRKDIPS
FERYMAQLKCYYFDYKEQLPESAYMHQLLGLNLLFLLSQNRVAEFHTELERLPAKDIQTNVYIKHPVSLE
QYLMEGSYNKVFLAKGNIPAESYTFFIDILLDTIRDEIAGCIEKAYEKILFTEATRILFFNTPKKMTDYA
KKRGWVLGPNNYYSFASQQQKPEDTTIPSTELAKQVIEYARQLEMIV

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_002803
RefSeq Size 1556
RefSeq ORF 771
Synonyms HEL-S-91n; HIP6; HYPF; Nin1p; p31; Rpn12; S14
Locus ID 5714
UniProt ID P48556
Cytogenetics 19q13.2
Summary The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a non-ATPase subunit of the 19S regulator. A pseudogene has been identified on chromosome 1. provided by RefSeq, Jul 2008
Protein Pathways Proteasome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "PSMD8" proteins (3)
SKU Description Size Price
LC419092 Lyophilized PSMD8 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY419092 Transient overexpression lysate of proteasome (prosome, macropain) 26S subunit, non-ATPase, 8 (PSMD8) (as WB positive control) 100 ug
$436.00
TP300436 Recombinant protein of human proteasome (prosome, macropain) 26S subunit, non-ATPase, 8 (PSMD8), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products