AK6 (NM_016283) Human Mass Spec Standard

SKU PH300412

TAF9 MS Standard C13 and N15-labeled recombinant protein (NP_057367)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC200412]
• Predicted MW: 20.1 kDa
• Protein Sequence:
  Protein Sequence

  >RC200412 protein sequence; Red=Cloning site Green=Tags(s); ; MLLPNILLTGTPGVGKTTLGKELASKSGLKYINVGDLAREEQLYDGYDEEYDCPILDEDRVVDELDNQMR; EGGVIVDYHGCDFFPERWFHIVFVLRTDTNVLYERLETRGYNEKKLTDNIQCEIFQVLYEEATASYKEEI; VHQLPSNKPEELENNVDQILKWIEQWIKDHNS; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_057367
• RefSeq Size: 962
• RefSeq ORF: 516
• Synonyms: AD-004; CGI-137; CINAP; CIP; hCINAP
• Locus ID: 102157402
• UniProt ID: Q9Y3D8
• Cytogenetics: 5q13.2
• Summary: This gene encodes a protein that belongs to the adenylate kinase family of enzymes. The protein has a nuclear localization and contains Walker A (P-loop) and Walker B motifs and a metal-coordinating residue. The protein may be involved in regulation of Cajal body formation. In human, AK6 and TAF9 (GeneID: 6880) are two distinct genes that share 5' exons. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2013]