PAFAH2 (NM_000437) Human Mass Spec Standard

SKU
PH300355
PAFAH2 MS Standard C13 and N15-labeled recombinant protein (NP_000428)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC200355]
Predicted MW 44 kDa
Protein Sequence
Protein Sequence
>RC200355 protein sequence
Red=Cloning site Green=Tags(s)

MGVNQSVGFPPVTGPHLVGCGDVMEGQNLQGSFFRLFYPCQKAEETMEQPLWIPRYEYCTGLAEYLQFNK
RCGGLLFNLAVGSCRLPVSWNGPFKTKDSGYPLIIFSHGLGAFRTLYSAFCMELASRGFVVAVPEHRDRS
AATTYFCKQAPEENQPTNESLQEEWIPFRRVEEGEKEFHVRNPQVHQRVSECLRVLKILQEVTAGQTVFN
ILPGGLDLMTLKGNIDMSRVAVMGHSFGGATAILALAKETQFRCAVALDAWMFPLERDFYPKARGPVFFI
NTEKFQTMESVNLMKKICAQHEQSRIITVLGSVHRSQTDFAFVTGNLIGKFFSTETRGSLDPYEGQEVMV
RAMLAFLQKHLDLKEDYNQWNNLIEGIGPSLTPGAPHHLSSL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_000428
RefSeq Size 3581
RefSeq ORF 1176
Synonyms HSD-PLA2
Locus ID 5051
UniProt ID Q99487
Cytogenetics 1p36.11
Summary This gene encodes platelet-activating factor acetylhydrolase isoform 2, a single-subunit intracellular enzyme that catalyzes the removal of the acetyl group at the SN-2 position of platelet-activating factor (identified as 1-O-alkyl-2-acetyl-sn-glyceryl-3-phosphorylcholine). However, this lipase exhibits a broader substrate specificity than simply platelet activating factor. Two other isoforms of intracellular platelet-activating factor acetylhydrolase exist, and both are multi-subunit enzymes. Additionally, there is a single-subunit serum isoform of this enzyme. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome
Protein Pathways Ether lipid metabolism, Metabolic pathways
Write Your Own Review
You're reviewing:PAFAH2 (NM_000437) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC424709 PAFAH2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY424709 Transient overexpression lysate of platelet-activating factor acetylhydrolase 2, 40kDa (PAFAH2) 100 ug
$436.00
TP300355 Recombinant protein of human platelet-activating factor acetylhydrolase 2, 40kDa (PAFAH2), 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.