OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

UXT (NM_004182) Human Mass Spec Standard

Be the first to review this product
SKU
PH300343
UXT MS Standard C13 and N15-labeled recombinant protein (NP_004173)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA303316 Goat Polyclonal Antibody against UXT
100 ug
$565.00
LY418160 Transient overexpression lysate of ubiquitously-expressed transcript (UXT), transcript variant 2 (as WB positive control) 100 ug
$436.00

Other products for "UXT or NM_004182"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC200343
Predicted MW 18.2 kDa
Protein Sequence
Protein Sequence
>RC200343 protein sequence
Red=Cloning site Green=Tags(s)

MATPPKRRAVEATGEKVLRYETFISDVLQRDLRKVLDHRDKVYEQLAKYLQLRNVIERLQEAKHSELYMQ
VDLGCNFFVDTVVPDTSRIYVALGYGFFLELTLAEALKFIDRKSSLLTELSNSLTKDSMNIKAHIHMLLE
GLRELQGLQNFPEKPHH

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_004173
RefSeq Size 619
RefSeq ORF 471
Synonyms ART-27; STAP1
Locus ID 8409
UniProt ID Q9UBK9
Cytogenetics Xp11.23
Summary The protein encoded by this gene functions as a cofactor that modulates androgen receptor-dependent transcription, and also plays a critical role in tumor necrosis factor-induced apoptosis. Expression of this gene may play a role in tumorigenesis. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. provided by RefSeq, Nov 2011
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "UXT" proteins (3)
SKU Description Size Price
LC418160 Lyophilized UXT HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY418160 Transient overexpression lysate of ubiquitously-expressed transcript (UXT), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP300343 Recombinant protein of human ubiquitously-expressed transcript (UXT), transcript variant 2, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products