RHEB (NM_005614) Human Mass Spec Standard

SKU PH300307

RHEB MS Standard C13 and N15-labeled recombinant protein (NP_005605)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC200307]
• Predicted MW: 20.3 kDa
• Protein Sequence:
  Protein Sequence

  >RC200307 representing NM_005614; Red=Cloning site Green=Tags(s); ; MPQSKSRKIAILGYRSVGKSSLTIQFVEGQFVDSYDPTIENTFTKLITVNGQEYHLQLVDTAGQDEYSIF; PQTYSIDINGYILVYSVTSIKSFEVIKVIHGKLLDMVGKVQIPIMLVGNKKDLHMERVISYEEGKALAES; WNAAFLESSAKENQTAVDVFRRIILEAEKMDGAASQGKSSCSVM; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_005605
• RefSeq Size: 1396
• RefSeq ORF: 552
• Synonyms: RHEB2
• Locus ID: 6009
• UniProt ID: Q15382
• Cytogenetics: 7q36.1
• Summary: This gene is a member of the small GTPase superfamily and encodes a lipid-anchored, cell membrane protein with five repeats of the RAS-related GTP-binding region. This protein is vital in regulation of growth and cell cycle progression due to its role in the insulin/TOR/S6K signaling pathway. The protein has GTPase activity and shuttles between a GDP-bound form and a GTP-bound form, and farnesylation of the protein is required for this activity. Three pseudogenes have been mapped, two on chromosome 10 and one on chromosome 22. [provided by RefSeq, Jul 2008]
• Protein Pathways: Insulin signaling pathway, mTOR signaling pathway