OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

YKT6 (NM_006555) Human Mass Spec Standard

Be the first to review this product
SKU
PH300260
YKT6 MS Standard C13 and N15-labeled recombinant protein (NP_006546)
Size:
10 ug
  $3,360.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA359867 YKT6 Antibody - C-terminal region
100 ul
$585.00
LY416570 Transient overexpression lysate of YKT6 v-SNARE homolog (S. cerevisiae) (YKT6) (as WB positive control) 100 ug
$436.00

Other products for "YKT6 or NM_006555"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC200260
Predicted MW 22.4 kDa
Protein Sequence
Protein Sequence
>RC200260 protein sequence
Red=Cloning site Green=Tags(s)

MKLYSLSVLYKGEAKVVLLKAAYDVSSFSFFQRSSVQEFMTFTSQLIVERSSKGTRASVKEQDYLCHVYV
RNDSLAGVVIADNEYPSRVAFTLLEKVLDEFSKQVDRIDWPVGSPATIHYPALDGHLSRYQNPREADPMT
KVQAELDETKIILHNTMESLLERGEKLDDLVSKSEVLGTQSKAFYKTARKQNSCCAIM

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_006546
RefSeq Size 2783
RefSeq ORF 594
Locus ID 10652
UniProt ID O15498
Cytogenetics 7p13
Summary This gene product is one of the SNARE recognition molecules implicated in vesicular transport between secretory compartments. It is a membrane associated, isoprenylated protein that functions at the endoplasmic reticulum-Golgi transport step. This protein is highly conserved from yeast to human and can functionally complement the loss of the yeast homolog in the yeast secretory pathway. provided by RefSeq, Jul 2008
Protein Pathways SNARE interactions in vesicular transport
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "YKT6" proteins (4)
SKU Description Size Price
LC416570 Lyophilized YKT6 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY416570 Transient overexpression lysate of YKT6 v-SNARE homolog (S. cerevisiae) (YKT6) (as WB positive control) 100 ug
$436.00
TP300260 Recombinant protein of human YKT6 v-SNARE homolog (S. cerevisiae) (YKT6), 20 µg 20 ug
$867.00
TP720932 Purified recombinant protein of Human YKT6 v-SNARE homolog (S. cerevisiae) (YKT6) 10 ug
$340.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products