YKT6 (NM_006555) Human Tagged ORF Clone

SKU
RC200260
YKT6 (Myc-DDK-tagged)-Human YKT6 v-SNARE homolog (S. cerevisiae) (YKT6)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol YKT6
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC200260 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAAGCTGTACAGCCTCAGCGTCCTCTACAAAGGCGAGGCCAAGGTGGTGCTGCTCAAAGCCGCATACG
ATGTGTCTTCCTTCAGCTTTTTCCAGAGATCCAGCGTTCAGGAATTCATGACCTTCACGAGTCAACTGAT
TGTGGAGCGCTCATCGAAAGGCACTAGAGCTTCTGTCAAAGAACAAGACTATCTGTGCCACGTCTACGTC
CGGAATGATAGTCTTGCAGGTGTGGTCATTGCTGACAATGAATACCCATCCCGGGTGGCCTTTACCTTGC
TGGAGAAGGTACTAGATGAATTCTCCAAGCAAGTCGACAGGATAGACTGGCCAGTAGGATCCCCTGCTAC
AATCCATTACCCAGCCCTGGATGGTCACCTCAGTAGATACCAGAACCCACGAGAAGCTGATCCCATGACT
AAAGTGCAGGCCGAACTAGATGAGACCAAAATCATTCTGCACAACACCATGGAGTCTCTGTTAGAGCGAG
GTGAGAAGCTAGATGACTTGGTGTCCAAATCCGAGGTGCTGGGAACACAGTCTAAAGCCTTCTATAAAAC
TGCCCGGAAACAAAACTCATGCTGTGCCATCATG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC200260 protein sequence
Red=Cloning site Green=Tags(s)

MKLYSLSVLYKGEAKVVLLKAAYDVSSFSFFQRSSVQEFMTFTSQLIVERSSKGTRASVKEQDYLCHVYV
RNDSLAGVVIADNEYPSRVAFTLLEKVLDEFSKQVDRIDWPVGSPATIHYPALDGHLSRYQNPREADPMT
KVQAELDETKIILHNTMESLLERGEKLDDLVSKSEVLGTQSKAFYKTARKQNSCCAIM

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_006555
ORF Size 594 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_006555.4
RefSeq Size 2783 bp
RefSeq ORF 597 bp
Locus ID 10652
UniProt ID O15498
Cytogenetics 7p13
Domains synaptobrevin
Protein Pathways SNARE interactions in vesicular transport
MW 22.4 kDa
Summary This gene product is one of the SNARE recognition molecules implicated in vesicular transport between secretory compartments. It is a membrane associated, isoprenylated protein that functions at the endoplasmic reticulum-Golgi transport step. This protein is highly conserved from yeast to human and can functionally complement the loss of the yeast homolog in the yeast secretory pathway. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:YKT6 (NM_006555) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC200260L1 Lenti ORF clone of Human YKT6 v-SNARE homolog (S. cerevisiae) (YKT6), Myc-DDK-tagged 10 ug
$600.00
RC200260L2 Lenti ORF clone of Human YKT6 v-SNARE homolog (S. cerevisiae) (YKT6), mGFP tagged 10 ug
$600.00
RC200260L3 Lenti ORF clone of Human YKT6 v-SNARE homolog (S. cerevisiae) (YKT6), Myc-DDK-tagged 10 ug
$600.00
RC200260L4 Lenti ORF clone of Human YKT6 v-SNARE homolog (S. cerevisiae) (YKT6), mGFP tagged 10 ug
$600.00
RG200260 YKT6 (tGFP-tagged) - Human YKT6 v-SNARE homolog (S. cerevisiae) (YKT6) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC116037 YKT6 (untagged)-Human YKT6 v-SNARE homolog (S. cerevisiae) (YKT6) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.