Calnexin (CANX) (NM_001746) Human Mass Spec Standard

SKU
PH300229
CANX MS Standard C13 and N15-labeled recombinant protein (NP_001737)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC200229]
Predicted MW 67.6 kDa
Protein Sequence
Protein Sequence
>RC200229 protein sequence
Red=Cloning site Green=Tags(s)

MEGKWLLCMLLVLGTAIVEAHDGHDDDVIDIEDDLDDVIEEVEDSKPDTTAPPSSPKVTYKAPVPTGEVY
FADSFDRGTLSGWILSKAKKDDTDDEIAKYDGKWEVEEMKESKLPGDKGLVLMSRAKHHAISAKLNKPFL
FDTKPLIVQYEVNFQNGIECGGAYVKLLSKTPELNLDQFHDKTPYTIMFGPDKCGEDYKLHFIFRHKNPK
TGIYEEKHAKRPDADLKTYFTDKKTHLYTLILNPDNSFEILVDQSVVNSGNLLNDMTPPVNPSREIEDPE
DRKPEDWDERPKIPDPEAVKPDDWDEDAPAKIPDEEATKPEGWLDDEPEYVPDPDAEKPEDWDEDMDGEW
EAPQIANPRCESAPGCGVWQRPVIDNPNYKGKWKPPMIDNPSYQGIWKPRKIPNPDFFEDLEPFRMTPFS
AIGLELWSMTSDIFFDNFIICADRRIVDDWANDGWGLKKAADGAAEPGVVGQMIEAAEERPWLWVVYILT
VALPVFLVILFCCSGKKQTSGMEYKKTDAPQPDVKEEEEEKEEEKDKGDEEEEGEEKLEEKQKSDAEEDG
GTVSQEEEDRKPKAEEDEILNRSPRNRKPRRE

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001737
RefSeq Size 4953
RefSeq ORF 1776
Synonyms CNX; IP90; P90
Locus ID 821
UniProt ID P27824
Cytogenetics 5q35.3
Summary This gene encodes a member of the calnexin family of molecular chaperones. The encoded protein is a calcium-binding, endoplasmic reticulum (ER)-associated protein that interacts transiently with newly synthesized N-linked glycoproteins, facilitating protein folding and assembly. It may also play a central role in the quality control of protein folding by retaining incorrectly folded protein subunits within the ER for degradation. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Jun 2018]
Protein Families Druggable Genome, Transmembrane
Protein Pathways Antigen processing and presentation
Write Your Own Review
You're reviewing:Calnexin (CANX) (NM_001746) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC419769 CANX HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC422525 CANX HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY419769 Transient overexpression lysate of calnexin (CANX), transcript variant 1 100 ug
$436.00
LY422525 Transient overexpression lysate of calnexin (CANX), transcript variant 2 100 ug
$436.00
TP300229 Recombinant protein of human calnexin (CANX), transcript variant 1, 20 µg 20 ug
$737.00
TP760886 Purified recombinant protein of Human calnexin (CANX), transcript variant 2, full length, with N-terminal HIS tag, expressed in E. coli, 50ug 50 ug
$261.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.